RetrogeneDB ID:
retro_ecab_480
Organism:
Horse ( Equus_caballus )
Location:
2:4283869-4284363 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
61.58 %
Coverage:
55.7 %
Frameshifts:
9
Stop codons:
1


Parental gene:
Parental gene symbol:
GPS2
Parental gene aliases:
No gene alias available
Parental gene description:
G protein pathway suppressor 2 [Source:HGNC Symbol;Acc:4550]

Genomic region (view in browser)





>retro_ecab_480
TCAGCACGCGGGAGCCCTGGAGGATGCCATAGCCCAGTGCCCTCACGGCAGCCGACAGAG
CCAAACAGATGTTTGGACCCAAGTGCTTCCAACCCAGCACTATATGGGCTCAGCAGCTGC
TTTCGAGAGACCGCAGAACACGGGCAATACCAAGACAGCCCAGGCACGCCCATGGACTGC
TCAGCCCCAGCTCACCACACACCCGCCCAGCCAGCCCATAGTCCTGGTCAGCAGCTCAGA
GCACACGTAAGTGCTTCCTGCAGCACGGTGCCCATCTCAGCCTCAGTCGCAGCCACCGCC
CCGTGCTGTGCATGGCCACTTTCAGCCCACCAGACAGGGCTCCTGCAGCCTGCCGGGGCC
CCATCCTTGCAGAAGCAGATGGATGTGCCAACCAGTGGACTGGCTTCTCTGACTTATCCT
CCCTGTGCCCCACACACCCCAGCTCTGCATCCAGCCCCTGGGTTCCTTCCGACCCCTAGC
CCCCTGTGCAGATG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.12
SRP021940_cerebellum 0.1
SRP021940_embryo 0.26
SRP021940_placental_villous 0.22
SRP021940_synovial_membrane 0.16
SRP021940_testis 0.89

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SMQGSPGGHNRP-GTLMAADRAKQMFGP-QVLTTRHYVGSAAAFAG-TPEHGQFQGSPGG-AYG-TAQP-PPHYGPTQPAYSPSQQLRAPSA-FPAVQYL
S..GSPGG...P...L.AADRAKQMFGP.QVL.T.HY.GSAAAF...T.EHGQ.Q.SPG..A.G.TAQP.P.H..P.QPA.SP.QQLRA.....PA....
Retrocopy
SARGSPGGCHSP/SALTAADRAKQMFGP/QVLPTQHYMGSAAAFER/TAEHGQYQDSPGT/AHG/TAQP/PAHHTPAQPAHSPGQQLRAHVS\LPAARCP


Parental protein
SQPQ--PQPYAVHSHFQPT-QTGFLQPGGALSLQKQME-HANQQTGFSDSSSLRPMHPQALHPAPGLLASPQLPVQM
SQPQ..P.P.AVH.HFQPT.QTG.LQP.GA.SLQKQM...ANQ.TGFSD.SSL.P.HP......P.....P..PVQM
Retrocopy
SQPQSQPPPRAVHGHFQPT/QTGLLQPAGAPSLQKQMD/CANQWTGFSDLSSLCPTHPSSA-SSPWVPSDP*PPVQM


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide