RetrogeneDB ID:
retro_ecab_481
Organism:
Horse ( Equus_caballus )
Location:
2:5978412-5979278 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
76.35 %
Coverage:
80.17 %
Frameshifts:
8
Stop codons:
0


Parental gene:
Parental gene symbol:
SLC25A3
Parental gene aliases:
No gene alias available
Parental gene description:
solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 3 [Source:HGNC Symbol;Acc:10989]

Genomic region (view in browser)





>retro_ecab_481
GGCGGCATGCTGAGCTGCCGCTGACGCACACGGCCATCGTGCCCTGGACCTGGTCAAGTG
CCGCATGCAGGTGGACCCCGGCAAGTACTCAGGGCATCCTCAGCGGCTTCTGGCGTGACG
CTGCGGGACGAACGGGCTGCGCGACCTGGCCCGACGACTGAGACCCCGAACTTTCCTGGG
CTACTCGCTGCAGAGACTCTTCAAGTACGGCCTGTACGAGATCTTCAAAGTACACTACGC
GGAGCGCCTGAGCCCGAGAGGGGCTACGCCTGGAGGACCGGCCTGTACCTGACCGCCTCG
GCCAGCGCCGAGTTCTTCGCCCGACGTGGCGCTGGCCCCCATGGAGGCGGTGAAGGTGCG
CATCCAGACGCAGCCCGGCTTCGCCCCGCACGCTGCGGGCCGCCGCCCCGCGCATGTACG
GCGAGGAGGGCCTGCGGGCCTTCTACAAGGGCGTGGCGCCGCTCTGGCTGCGGCAGATCC
CCTACACCATGATGAAGTTCGCCTGCTTCGAGCGCACGGTGGAGGCGCTCTACACCTACG
TGGTGCCCAAGCCCCAGAGCCAGTGCTCCAAGGCCGAGCAGCTGGCCGTGACCTTCGTGG
CCGGCTACATCGCCGGCGTCTTCTGTGCCGTCGTGTCCCACCCGGCCGATTCCGTCGTGT
CCGTTTTGAACAAGGAGAAAGGCAGCACGGCCTTCGGGGTTCTCCGCAGACTGGGGTTCT
GGGGCGTGTGGAAGGGCCTGTTCGCCCGGATCATCATGATCGGCACCCTGACTGCGCTGC
AGTGGTTCATCTACGACTCGGTCAAGGTCTATTTCAAGCTGCCTCGCCCTCCGGTCCCGC
AACCGCCCGAATCCCTGAAAGAGCAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.13
SRP021940_synovial_membrane 0.03
SRP021940_testis 28.24

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GGVLSCG-LTHTAVVP-LDLVKCRMQVDPQKY-KGIFNGF-SVTLKED-GVRGLAKGWAP-TFIGYSLQGLCKFGFYEVFKVLYSNVLGE-ENAYVWRTS
GG.LSC..LTHTA.VP.LDLVKCRMQVDP.KY..GI..GF..VTL....G.R.LA....P.TF.GYSLQ.L.K.G.YE.FKV.Y...L...E..Y.WRT.
Retrocopy
GGMLSCR/LTHTAIVP/LDLVKCRMQVDPGKY\QGILSGF\GVTLRDE\GLRDLARRLRPRTFLGYSLQRLFKYGLYEIFKVHYAERLSP/ERGYAWRTG


Parental protein
LYLAASASAEFFA-DIALAPMEATKVRIQTQPGYA-NTLRDAAPKMYKEEGLKAFYKGVAPLWMRQIPYTMMKFACFERTVEALYKFVVPKPRSECSKPE
LYL.ASASAEFFA.D.ALAPMEA.KVRIQTQPG.A..TLR.AAP.MY.EEGL.AFYKGVAPLW.RQIPYTMMKFACFERTVEALY..VVPKP.S.CSK.E
Retrocopy
LYLTASASAEFFA\DVALAPMEAVKVRIQTQPGFA\RTLRAAAPRMYGEEGLRAFYKGVAPLWLRQIPYTMMKFACFERTVEALYTYVVPKPQSQCSKAE


Parental protein
QLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSSASQVLQRLGFKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKK
QL.VTFVAGYIAGVFCA.VSHPADSVVSVLNKEKGS.A..VL.RLGF.GVWKGLFARIIMIGTLTALQWFIYDSVKVYF.LPRPP.P..PESLK..
Retrocopy
QLAVTFVAGYIAGVFCAVVSHPADSVVSVLNKEKGSTAFGVLRRLGFWGVWKGLFARIIMIGTLTALQWFIYDSVKVYFKLPRPPVPQPPESLKEQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide