RetrogeneDB ID:
retro_ecab_485
Organism:
Horse ( Equus_caballus )
Location:
2:34618551-34618864 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
76.19 %
Coverage:
80.0 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
RPS15A
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S15a [Source:HGNC Symbol;Acc:10389]

Genomic region (view in browser)





>retro_ecab_485
AGAAGAGACGCAGATGACGTTCTCACTAGGCCGTGCTCCGGGGGTCGTCATCCGGTTTCT
GACTGTGATGGTGAAGTGTGGTTCCATTGGCAGGTCTGAGATCACTGATGACCACAGAGC
CGGGATGATTGTTGTGAACGTCACCGGCAGATTAAACAAGTGTGGAGGGATCAGCCGCAG
ATTTCAGGTGCAACTGAAAGATCAAGAAAAATGGCAGAATAACTTACTCCCGTCCCGTCA
GTTTGGTTTCATTGTACTAACCACCTCAGCTGGCATCATGGACCATGAAGAAGCAAAACG
GAAACAGGAGGGA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.64
SRP021940_cerebellum 0.85
SRP021940_embryo 2.52
SRP021940_placental_villous 1.16
SRP021940_synovial_membrane 2.21
SRP021940_testis 4.75

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KRGKRQVLIRPCSK-VIVRFLTVMMKHGYIGEFEIIDDHRAGKIVVNLTGRLNKCGVISPRFDVQLKDLEKWQNNLLPSRQFGFIVLTTSAGIMDHEEAR
.R....VL.RPCS..V..RFLTVM.K.G.IG..EI.DDHRAG.IVVN.TGRLNKCG.IS.RF.VQLKD.EKWQNNLLPSRQFGFIVLTTSAGIMDHEEA.
Retrocopy
RRDADDVLTRPCSG\VVIRFLTVMVKCGSIGRSEITDDHRAGMIVVNVTGRLNKCGGISRRFQVQLKDQEKWQNNLLPSRQFGFIVLTTSAGIMDHEEAK


Parental protein
RKHTG
RK..G
Retrocopy
RKQEG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide