RetrogeneDB ID:
retro_ecab_489
Organism:
Horse ( Equus_caballus )
Location:
2:51392161-51392380 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
71.23 %
Coverage:
71.57 %
Frameshifts:
0
Stop codons:
1


Parental gene:
Parental gene symbol:
PCBD2
Parental gene aliases:
No gene alias available
Parental gene description:
pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 [Source:HGNC Symbol;Acc:24474]

Genomic region (view in browser)





>retro_ecab_489
AGAGATGCCATGTACAGAGAATTCTCTTTTAAAAATTTTAATCAGGCATTTGGCTTTATC
TCCCAAGTTACCATACAAGCAGAGAAGATAAAGCATCACCCAGAATAGTTCAATGGGCAT
TACAAGGTCCAGATAACTTTCACCTTGCATGTCTGGGGTGGAGTGACCAAAAGAAATGTG
AAATTGGTCAAGTTTTTTGAAAAAGCAGCTGTTTCTGTG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.35
SRP021940_embryo 0.07
SRP021940_placental_villous 0.09
SRP021940_synovial_membrane 0.1
SRP021940_testis 0.42

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RDAIYKEFSFKNFNQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGGLTKRDVKLAKFIEKAAASV
RDA.Y.EFSFKNFNQAFGF.S.V..QAEK..HHPE.FN...KVQIT.T.H..GG.TKR.VKL.KF.EKAA.SV
Retrocopy
RDAMYREFSFKNFNQAFGFISQVTIQAEKIKHHPE*FNGHYKVQITFTLHVWGGVTKRNVKLVKFFEKAAVSV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide