RetrogeneDB ID:
retro_ecab_49
Organism:
Horse ( Equus_caballus )
Location:
8:41121808-41122327 (+)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
84.21 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
CETN2
Parental gene aliases:
No gene alias available
Parental gene description:
centrin, EF-hand protein, 2 [Source:HGNC Symbol;Acc:1867]

Genomic region (view in browser)





>retro_ecab_49
ATGGCTTCCAGCTTTAAGAAGACAAATTCTGCCTCTACCAGCCAGAAAAGAAAGGTGGGT
CCTAAGCCTGAACTCACTGAAGATCAGAAGCAAGAAGTTCGAGAAGCGTTTGACCTCTTC
GATGCCAACGGAAGCGGGACCATCGACGTGAAGGAGCTGAAGGTGGCCATGAGAGCGTTG
GGCTTTGAACCCAGGAAGGAGGAGATGAAGAAGATGATCTCCGAAGTGGACAAAGAAGGC
ACGGGGAAAATCAGCTTCAATGACTTCCTGGCCGTGATGACTCAGAAGATGGCCGAGAAA
GACACCAAAGAAGAAATCCTGAAGGCTTTCAGGCTCTTTGATGATGATGAAACTGGGAAG
ATCTCTTTCAAAAACCTAAAGCGCGTGGCCAACGAGTTGGGGGAAAACCTCACTGATGAG
GAGCTGCAGGAAATGATTGACGAAGCCGACCGCGATGGAGACGGGGAAGTGAACCAGGAA
GAGTTTCTCCGGATCATGAAAAAGACCAACCTATATTAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.09
SRP021940_synovial_membrane 0.0
SRP021940_testis 167.27

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ASNFKKANMASTSQRKRMSPKPELTEEQQQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFSDFLTVMTQKMSEKD
AS.FKK.N.ASTSQ.....PKPELTE.Q.QE.REAFDLFDA.G.GTIDVKELKVAMRALGFEP.KEE.KKMISE.DKEGTGK..F.DFL.VMTQKM.EKD
Retrocopy
ASSFKKTNSASTSQKRKVGPKPELTEDQKQEVREAFDLFDANGSGTIDVKELKVAMRALGFEPRKEEMKKMISEVDKEGTGKISFNDFLAVMTQKMAEKD


Parental protein
TKEEILKAFKLFDDDETGTISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVNEQEFLRIMKKTSLY
TKEEILKAF.LFDDDETG.ISFKNLKRVA.ELGENLTDEELQEMIDEADRDGDGEVN..EFLRIMKKT.LY
Retrocopy
TKEEILKAFRLFDDDETGKISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVNQEEFLRIMKKTNLY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide