RetrogeneDB ID:
retro_ecab_490
Organism:
Horse ( Equus_caballus )
Location:
2:51964391-51964818 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
69.13 %
Coverage:
98.66 %
Frameshifts:
2
Stop codons:
1


Parental gene:
Parental gene symbol:
STMN1
Parental gene aliases:
No gene alias available
Parental gene description:
stathmin 1 [Source:HGNC Symbol;Acc:6510]

Genomic region (view in browser)





>retro_ecab_490
ACTTCTGATATTCAAATGAAAGTCTGAAGAAGTGTCCCTCAGGCCAGGCTTCTGAGCAGT
TTCTCAGTCCTTGGTCAAAAGAATCCATCCCAGCATTCTCCCTTTCACCTCCAAAGAAGA
GTCTTTCCCTGCAGGAAATTCAGAAGAAATTAGAAGCCGCAAAAGAAAGACACAAGTCCC
AAGAAGGTGAGGTCTTGAAGCAGCTTGCTGAGAAAGGAGAGCACCAGAAACAAATGTTTC
AGAAAGCAGTAGAAGAGAACACAACTTCAGTAAAATGGCAGAAGAGGAGCTGACCCACAA
AATGGAAGAGAACCAAGAGGCACAGATGGATTCCAAGCTGGAGCACGTGTGAGAGAAAGA
CAAGCACGTGGAAGAAGCATGGGAGAAGCATGAATTCAAAGACCCTGCCGATGAGACTGA
GGCTGAC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.12
SRP021940_cerebellum 0.0
SRP021940_embryo 0.05
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.05
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SSDIQVK-ELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEEN-NNFSKMAEEK
.SDIQ.K..L.K..SGQA.E..LSP.SKES.P.F.LSPPKK..LSL.EIQKKLEAA.ER.KS.E.EVLKQLAEK.EH.K...QKA.EEN..NFSKMAEE.
Retrocopy
TSDIQMK/SLKKCPSGQASEQFLSPWSKESIPAFSLSPPKKS-LSLQEIQKKLEAAKERHKSQEGEVLKQLAEKGEHQKQMFQKAVEEN/HNFSKMAEEE


Parental protein
LTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD
LTHKME...EN.EAQM..KLE...EKDKH.EE.....E.KDPADETEAD
Retrocopy
LTHKME---ENQEAQMDSKLEHV*EKDKHVEEAWEKHEFKDPADETEAD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide