RetrogeneDB ID:
retro_ecab_494
Organism:
Horse ( Equus_caballus )
Location:
2:65896628-65897363 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
70.4 %
Coverage:
96.09 %
Frameshifts:
3
Stop codons:
1


Parental gene:
Parental gene symbol:
ATP5F1
Parental gene aliases:
No gene alias available
Parental gene description:
ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 [Source:HGNC Symbol;Acc:840]

Genomic region (view in browser)





>retro_ecab_494
ATGCTGTCCCACATGGTACTTTCTGCTGCCACCACAGCAGCCACCTCTGAGGAACACAGC
CCTTCTTGGTCCAGGGGTATTGCAGGCAACAAGGATCTTTCACACGGGGCAGCCAAGTCT
TGCTGCTGTACCACGTCTTCCTGAATATGGAGGAAAAGTTCTTTTGGGGCCGATCCCTCA
GGAATTCTTCCAGTTTCTTTATCCTAAAACCGGTACAACAGGACCCTATATGCTCAGAAC
TGGGCTTGTCTTATATTTTCTCTCCAAAGAAATATATGTGATTACTCCAGAGACCATCTC
TGCCATATCAACAATAGAGTTTCTTGTCTTAAGTAATTAAAAAATATGGTGCCTCTATTG
GAGAATTTGCTGAGAAACATGTTGAAAAAAAAAATGGCCCAACTACAAGAGGTGAAGCAG
GCTTCCATCAAACACATCCAGGCTGCGACTGATCTGGAGAAGTCACAGCAGGCACTGGTT
CAAAAGCTCCATTACCTTTTTGATCTCCAGAGGAATAACATTGCTATGGCCTCAGAGGGT
GCTCACTAGGAACGCTGCCTGGAGTACACAGGAAGTAAAGAATTGCCTAGACTATCATAT
CTCCCTGCAGAATATGATGCGTTGAAGGAACAAGAGCACATGATAAAGTGGGTGGAGAAT
CACGTGGTACAGAGCATCTCCTCACAGCAGGAAAAGGAGACAATAGCCAAGTGCGTTTCG
GATCTAAAGCAGCTC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.12
SRP021940_placental_villous 0.04
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MLSRVVLSAAAAAA-PCLKNAALLGPGVLQATRIFHTGQPSLAPVPPLPEYGGKVRLGLIPEEFFQFLYPKTGVTGPYVLGTGLILYFLSKEIYVITPET
MLS..VLSA.A..A.P.L.N.ALLGPGVLQATRIFHTGQPSLA.VP.LPEYGGKV.LG.IP.EFFQFLYPKTG.TGPY.L.TGL.LYFLSKEIYVITPET
Retrocopy
MLSHMVLSA-ATTA\PPLRNTALLGPGVLQATRIFHTGQPSLAAVPRLPEYGGKVLLGPIPQEFFQFLYPKTGTTGPYMLRTGLVLYFLSKEIYVITPET


Parental protein
ISAISTIGVLVY-IVKKYGASIGEFADK-LNEQKIAQLEEVKQASIKQIQDAIDLEKSQQALVQKRHYLFDVQRNNIAMALELTYRER-LHRVYKEVKNR
ISAISTI..LV....KKYGASIGEFA.K.......AQL.EVKQASIK.IQ.A.DLEKSQQALVQK.HYLFD.QRNNIAMA.E....ER.L.........R
Retrocopy
ISAISTIEFLVL\VIKKYGASIGEFAEK\MLXXXXAQLQEVKQASIKHIQAATDLEKSQQALVQKLHYLFDLQRNNIAMASEGAH*ERCLEYTGSKELPR


Parental protein
LDYQISVQNMMRRKEQEHMVNWVEKHVVQSLSTQQEKETIAKCISDLKLL
L.Y.............EHM..WVE.HVVQS.S.QQEKETIAKC.SDLK.L
Retrocopy
LSYLPAEYDALKEQ--EHMIKWVENHVVQSISSQQEKETIAKCVSDLKQL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide