RetrogeneDB ID:
retro_ecab_495
Organism:
Horse ( Equus_caballus )
Location:
2:70591473-70591886 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
74.47 %
Coverage:
63.76 %
Frameshifts:
2
Stop codons:
2


Parental gene:
Parental gene symbol:
MRPL24
Parental gene aliases:
No gene alias available
Parental gene description:
mitochondrial ribosomal protein L24 [Source:HGNC Symbol;Acc:14037]

Genomic region (view in browser)





>retro_ecab_495
ATTTGGCAGTGAAACTGGGTGGGCCTGGATGGGCTGAACACATGCTTACCACTACATTGG
CAAGATCAAGGATTACCGGGGAACCGTGATCCCTAGCGAAACCCCCCTTGCTCCACTGCC
AGGTCAAACTTGTGGCTCCTGTGGAGAGAAAACCTACTGAAGTGGAGTGGAGATTCACTG
AGGCAGGAGATGAGGTATGGGTCATCACAAGATCAGGAAGAATTATCCCCAAACCTGAAT
TTCCCAGAGCTGATGGCATTGTCCCTGAAACATGGATTGATGACACCAAGAACACATCAG
TGGAAGATGCTCTAGAACAAACCTGTATGCCCCATCTAAAGACACTGGAAGAGGAGGCAG
TGGAGGCAATGGGGATCCAGGGGACTTAGAAACACAAGAAAGTCTGTTGGTAT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
IRQRNWVVLEGLNT-HYRYIGKTKDYRGTMIPSEAPL-LHHQVKLVDPPLTFGKPTEVEWRFTEAGERVRVSTRSGRIIPKPEFPRADGIVPETWTDGPK
I.Q.NWV.L.GLNT..Y.YIGK.KDYRGT.IPSE.PL.LH.QVKLV.P.....KPTEVEWRFTEAG..V.V.TRSGRIIPKPEFPRADGIVPETW.D..K
Retrocopy
IWQ*NWVGLDGLNT\AYHYIGKIKDYRGTVIPSETPL\LHCQVKLVAP--VERKPTEVEWRFTEAGDEVWVITRSGRIIPKPEFPRADGIVPETWIDDTK


Parental protein
DTSVEDALERTYVPRLKTLEEEVMEAMGIQETRRHKKVYWY
.TSVEDALE.T..P.LKTLEEE..EAMGIQ.T..HKKV.WY
Retrocopy
NTSVEDALEQTCMPHLKTLEEEAVEAMGIQGT*KHKKVCWY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide