RetrogeneDB ID:
retro_ecab_499
Organism:
Horse ( Equus_caballus )
Location:
2:82718495-82718798 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
72.28 %
Coverage:
80.8 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
RPL31
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L31 [Source:HGNC Symbol;Acc:10334]

Genomic region (view in browser)





>retro_ecab_499
TTGGTGAACAGAGAATGCACCATCAGCATTCACAAACACATCCATAGAGTGGGCTTCAAG
AAGCATGGCCCTCAGGCACTCAGAGAGATCCAGAAATTTGCCGTGAAGAAGATGGGAACT
CCCAATGTATACATTGATACCAGGCTCAACAAAGCTGTCTGGACCAATGGAATAAGGAAT
GTCCCATACAGAATCTGTGTGTTGTTGTCCAGAAGATGTAAAGAGGATGAAGATTCACCA
AACAAGCTCTGTACATTGGTTACCTATGTACTTCTCACCACTTTCAAAAGTCTACGGACA
ATG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.17
SRP021940_placental_villous 0.18
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VVTREYTINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPDVRIDTRLNKAVWAKGIRNVPYRIRVRLSRKRNEDEDSPNKLYTLVTYVPVTTFKNLQT
.V.RE.TI.IHK.IH.VGFKK..P.AL.EI.KFA.K.MGTP.V.IDTRLNKAVW..GIRNVPYRI.V.LSR...EDEDSPNKL.TLVTYV..TTFK.L.T
Retrocopy
LVNRECTISIHKHIHRVGFKKHGPQALREIQKFAVKKMGTPNVYIDTRLNKAVWTNGIRNVPYRICVLLSRRCKEDEDSPNKLCTLVTYVLLTTFKSLRT


Parental protein
V
.
Retrocopy
M


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide