RetrogeneDB ID:
retro_ecab_50
Organism:
Horse ( Equus_caballus )
Location:
28:45976319-45977120 (-)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
50.51 %
Coverage:
93.33 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
SCO1
Parental gene aliases:
No gene alias available
Parental gene description:
SCO1 cytochrome c oxidase assembly protein [Source:HGNC Symbol;Acc:10603]

Genomic region (view in browser)





>retro_ecab_50
ATGCTGCTGCTGGCCCTGGCACCCAGGGCTTGGCTCAGGCTCCCTCAGCTGAAGCGCCTG
GTCTGCCCTAGGACCCTGGGAGGTGATTCCCTACGCATGAGGTGCCAGCTCTTGTCAAGG
CAGGGTCCTGCAGAGACAGGCAAACAGGGCCAGCCCCAGGGCCCTGGGCTTCGAACTAGG
TTGCTGATCACAGCCTTGTTTGGGGCTGGGCTGGGTGGGGCCTGGCTGGCTGCAAGGGCT
AAGAAGGAGCAGTGGCGGCAGCAACGGCGGACAGAAGCCCTGCGTCAGGCAGCCGTGGGC
CAGGGCGACTTCAGTCTGCTGGACCACCGGGGCCAGGCTCGCTGCAAAGCTGACTTCCGG
GGCCAGTGGGTACTGATGTACTTTGGCTTTACTCACTGCCCTGACATCTGCCCAGATGAG
CTGGAGAAGTTGGTGCAGGTGGTACAGCAGCTGGAAGCTGAGCCTGGCCTGCCCCTGGTG
CAGCCCATCTTCATTACTGTGGACCCTGAGCGGGACAGCGTCGAGGCCATGGCCCGCTAT
GTGCAGGACTTCCACCCGAGGCTGCTGGGCCTGACTGGCTCTGCCGAGCAGATTGCTCAG
GCTAGCCACAACTACCGTGTATACTACAGTGCTGGCCCCAAAGACGAGGACCAGGATTAC
ATTGTGGATCACTCCATTGCTATCTACCTGCTTAACCCTGATGGCCTCTTCACAGACTAC
TATGGCCGGGCCAGGTCAGCTGAGCAGATTGCAGACAGCGTGCGGCACCACATGGCTACC
TTCCGCAGTGTCCTGCCCTGA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 4.18
SRP021940_cerebellum 14.14
SRP021940_embryo 10.23
SRP021940_placental_villous 6.62
SRP021940_synovial_membrane 7.76
SRP021940_testis 24.68

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AIGGALLAGMKYFKKEKTEKLEKQRQ-RSIGKPLLG-GPFSLTTHTGESKTDKDYLGQWVLIYFGFTHCPDVCPEELEKMIQVVDEIDSIPTLPDLTPLF
A..GA.L.G.......K.E....QR..........G.G.FSL..H.G......D..GQWVL.YFGFTHCPD.CP.ELEK..QVV......P.LP...P.F
Retrocopy
ALFGAGLGGAWLAARAKKEQWRQQRRTEALRQAAVGQGDFSLLDHRGQARCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVQQLEAEPGLPLVQPIF


Parental protein
ITIDPERDTKEAIANYVKEFSPKLIGLTGTKEEIDQVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPNGEFLDYFGQNKKNAEIAGSIAAHMREHR
IT.DPERD..EA.A.YV..F.P.L.GLTG..E.I.Q....YRVYYS.GPKDED.DYIVDH.I..YL..P.G.F.DY.G.......IA.S...HM...R
Retrocopy
ITVDPERDSVEAMARYVQDFHPRLLGLTGSAEQIAQASHNYRVYYSAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRARSAEQIADSVRHHMATFR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide