RetrogeneDB ID:
retro_ecab_501
Organism:
Horse ( Equus_caballus )
Location:
2:89814663-89817355 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
95.21 %
Coverage:
100.0 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
LPIN2
Parental gene aliases:
No gene alias available
Parental gene description:
lipin 2 [Source:HGNC Symbol;Acc:14450]

Genomic region (view in browser)





>retro_ecab_501
ATGAATTATGTGGGACAGCTGGCTGGGCAGGTGATTGTCACTGTGAAAGAACTCTACAAA
GGCGTTAACCAAGCCACTCTGTCCGGGTGCATCGATGTCATTGTGGTACGGCAGCAGGAT
GGCACCTATCAGTGTTCGCCATTTCAGGTTCGGTTCGGGAAGCTGGGAGTCCTGAGATCC
AAGGAGAAAGTGATTGATATAGAAATCAATGGCGATGCAGTGGATCTTCACATGAAATTG
GGTGACAATGGAGAAGCTTTCTTTGTGGAGGAGACTGAAGAGGAATATGAAAAGCTTCCT
GCTTACCTTGCCACCTCACCAATTCCTACTGAAGATCACTTCTTCAAAGATATTGACACC
CGTTTTGTGAAATCTGGTGGAAATGAAAGACCATCTCAGAGTTCAGACATCTCACACATC
TTGGACACGGAGAGAGATTTTGCTCCAAGTTCTGTGAAAAAGAAAAAACAAAGGACAAAG
AAATGCAAACAGGACAGTAAGAAGGAAGACCAGGCCACTTGCCCTGCTGCAGAGGACACC
GTGGATGTGAACCTGAGTTCTGACGATGGCAAGGGGGCCCAGTCAGCAAGAGGATCTTCA
AATGCTTCCTTAAAGGAAGAAGAATATAAAGAGCCTTTGCTTTTCCATTCTGGGGATCAA
TACTCCTTATCTGATGGAGACTGGTCGCCTTCAGACAACACCTATTCCCCAAGGGCAGTG
TGTCCTAAGAGCGATTCAGAGCTGGAGGTGAAACCAGCCGAGAGCCTGCTCAGATCTGAG
TCCCACATGGAGTGGACGTGGGGCGGGTTCCCACAGTCCACCAAGGTCAGCAAAAGAGAC
AGATCTGACCATCATCCTAGGACAGGTACGATTACACCATCAGAAAATACCCATTTTCGG
GTAATTTCAAGTGAGGACAGGCTCAGCAGTGAGGTTGAAAAGGATGCTTCCATGGGAGAA
ACGGTCTGTACCATAGTGAAACCCAAACCCAGAGCCCTGTGTAAGCAGATGAGCGATGCA
ACTAGAGCTGCAGGACTTGTCGAACCTCTCCTTGAGCCACCTCCGATTTCATCTATGTTA
GATGCAGACCACCTTCCCAACCCCTCGTTGCTGGAGGCTCCCTCAGAATCAAAACCAGCA
GCTAAGGTAGACTCGCCGTCAAAGAAGAAAGGTGTCCACAAGAGAAGCCAACACCAGGGA
CCTGATGATATTTACCTAGATGATTTAAAGGCTCTAGAACCTGAAGTCGCAGCTCTCTGT
TTCCCTAAAAGTGGATCAGACCCCGTCTCCAGGCAGTGACCCGAGTCTGACACGCCTTCT
GGCTCCCAGTCCCCGCAGTCCGTGGGAAGCGCGGCCACTGATAGTGGCACTGAGTGCCTC
TTGGATTCTACCATGGACTTGCCCGACGTCACCCTCTCCCTTTGTGGGGGCCTCAGTGAG
AATGGAGAAATTTCTAAAGAAAAATTCGTGGAGCATATCATTACTTATCATGAATTTGCA
GAAAACCCTGGACTTATAGACAATCCTAACCTTGTAATACGGATATATAACCGTTACTAT
AACTGGGCTTTGGCTGCTCCCATGATCCTTAGCTTACAAGTGTTCCAGAAGAGCTTGCCT
AAGGCCTCAGTCGAGTCCTGGGTCAAAGATAAGATGCCAAAGAAATCTGGTCGCTGGTGG
TTTTGGCGTAAGAGAGAAAGCATGACCAAACAGCTGCCGGAGGCCAAGGAAGGGAAATCC
GAGGTGCTTGCCGACGAGTGACCTGCCGTCAGGTGCAAAGGAGCTGGCCAGTGGCAGGTC
AGCCGAGGATGACTCGTCGAGTGACGAGGGATCACAGGAGCTCGAAGAATCAATCAAAGT
GGACCCCGTCCCCACAGAGCCCCCGAGCCACGGCAGCACGACCTCATATAAGAAGTCTCT
TCAACTCTCCTCAGACCAGATTGCAAAACTGAAGCTCCAAGATGGCCCAAATGATGTTGT
GTTTAGTATTACAACCCAGTATCAAGGTACCTGCCGTTGCGCAGGGACCATTTACCTGTG
GAACTGGAATGACAAGGTCATCATTTCAGATATCGATGGAACGATAATCAAGTCTGATGC
TTTGGGACAGATTCTTCCACAGCTGGGTAAAGACTGGACTCATCAGGGTATAGCAAAGCT
CTACCATTCCATCAACAAGAATGGCCACAAGTTTCTGTACTGTTCAGCTTGTGCCATCAG
CACGGCTGACGTGACCTGTGGCTACCTGCACTGAGTCAATGACAAGGGCACAATCTTGCC
CCGGGGCCCTCTGATGCTGTCCCCCAGCAGCTTGTTCTCGGCCTTCCACAGGGAAGTGAT
AGAAAAGAAACCAGAGAAGTTCAAAATTGAGTGTCTGAATGACATCAAGAATCTGTTTGC
CCCGTCTAAGCAGCCCTTCTATGCTGCCTTTGGAAACCGTCCCAGTGATGTCTATGCTTA
CACACAAGTTGGAGTTCCAGACTGCAGAATATTCACTGTGAACCCCAAGGGTGAATTAAT
ACAAGAAAGGACCAAAGGAAACAAGTCATTGTATCACAGACTGAGCGAGCTCGTGGAGCA
TGTATTCCCACTCCTCAGTAAGGAACAGAATTCCGCATGTCCGTGCCCAGAGTTCAGCTC
CTTCTGCTACTGGCGAGACCCGATCCCCAAAGTGGACCTGGATGACCTGGCC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.06
SRP021940_cerebellum 0.45
SRP021940_embryo 0.17
SRP021940_placental_villous 0.09
SRP021940_synovial_membrane 0.1
SRP021940_testis 0.24

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MNYVGQLAGQVIVTVKELYKGINQATLSGCIDVIVVRQQDGTYQCSPFHVRFGKLGVLRSKEKVIDIEINGDAVDLHMKLGDNGEAFFVEETEEEYEKLP
MNYVGQLAGQVIVTVKELYKG.NQATLSGCIDVIVVRQQDGTYQCSPF.VRFGKLGVLRSKEKVIDIEINGDAVDLHMKLGDNGEAFFVEETEEEYEKLP
Retrocopy
MNYVGQLAGQVIVTVKELYKGVNQATLSGCIDVIVVRQQDGTYQCSPFQVRFGKLGVLRSKEKVIDIEINGDAVDLHMKLGDNGEAFFVEETEEEYEKLP


Parental protein
AYLATSPIPTEDQFFKDIDTRLVKSGGNERPSQSSDISHILDTERVFAPSSVKKKKRRRKKCKQDSKKEDQATCPAAEDTVDVNLSSDDDKGAQSARGSS
AYLATSPIPTED.FFKDIDTR.VKSGGNERPSQSSDISHILDTER.FAPSSVKKKK.R.KKCKQDSKKEDQATCPAAEDTVDVNLSSDD.KGAQSARGSS
Retrocopy
AYLATSPIPTEDHFFKDIDTRFVKSGGNERPSQSSDISHILDTERDFAPSSVKKKKQRTKKCKQDSKKEDQATCPAAEDTVDVNLSSDDGKGAQSARGSS


Parental protein
NASLKEEEYKEPLLFHSGDHYPLSDGDWSPLDNAYSPTAVCPKSDSELEVKPAESLLRSESHMEWTWGGFPESTKVSKRDRSDHHPRTATITPSENTHFR
NASLKEEEYKEPLLFHSGD.Y.LSDGDWSP.DN.YSP.AVCPKSDSELEVKPAESLLRSESHMEWTWGGFP.STKVSKRDRSDHHPRT.TITPSENTHFR
Retrocopy
NASLKEEEYKEPLLFHSGDQYSLSDGDWSPSDNTYSPRAVCPKSDSELEVKPAESLLRSESHMEWTWGGFPQSTKVSKRDRSDHHPRTGTITPSENTHFR


Parental protein
VIPSEDSLSSEVEKDASMGETVCTIVKPKPRALCKQMSDATRGAGLVEPLLEPPPISSMLDADQLPNPLLLEAPSESKPAAKVDSPSKKKGVHKRSQHQG
VI.SED.LSSEVEKDASMGETVCTIVKPKPRALCKQMSDATR.AGLVEPLLEPPPISSMLDAD.LPNP.LLEAPSESKPAAKVDSPSKKKGVHKRSQHQG
Retrocopy
VISSEDRLSSEVEKDASMGETVCTIVKPKPRALCKQMSDATRAAGLVEPLLEPPPISSMLDADHLPNPSLLEAPSESKPAAKVDSPSKKKGVHKRSQHQG


Parental protein
PDDIYLDDLKALEPEVAALYFPKSESDPVSRQWPESDTPSGSQSPQSVGSAAADSGTECLLDSTMDLPDVTLSLCGGLSENGEISKEKFMEHIITYHEFA
PDDIYLDDLKALEPEVAAL.FPKS.SDPVSRQ.PESDTPSGSQSPQSVGSAA.DSGTECLLDSTMDLPDVTLSLCGGLSENGEISKEKF.EHIITYHEFA
Retrocopy
PDDIYLDDLKALEPEVAALCFPKSGSDPVSRQ*PESDTPSGSQSPQSVGSAATDSGTECLLDSTMDLPDVTLSLCGGLSENGEISKEKFVEHIITYHEFA


Parental protein
ENPGLIDNPNLVIRIYNRYYNWALAAPMILSLQVFQKSLPKATVESWVKDKMPKKSGRWWFWRKRESMTKQLPEAKEGKSEV-LPTSDLPSGAKEPASGR
ENPGLIDNPNLVIRIYNRYYNWALAAPMILSLQVFQKSLPKA.VESWVKDKMPKKSGRWWFWRKRESMTKQLPEAKEGKSEV.LPTSDLPSGAKE.ASGR
Retrocopy
ENPGLIDNPNLVIRIYNRYYNWALAAPMILSLQVFQKSLPKASVESWVKDKMPKKSGRWWFWRKRESMTKQLPEAKEGKSEV\LPTSDLPSGAKELASGR


Parental protein
SAEDDSSSDEGSQELEESIKVDPVPTEPPSHSGTTSYKKSLRLSSDQIAKLKLQDGPNDVVFSITTQYQGTCRCAGTIYLWNWNDKVIISDIDGTITKSD
SAEDDSSSDEGSQELEESIKVDPVPTEPPSH..TTSYKKSL.LSSDQIAKLKLQDGPNDVVFSITTQYQGTCRCAGTIYLWNWNDKVIISDIDGTI.KSD
Retrocopy
SAEDDSSSDEGSQELEESIKVDPVPTEPPSHGSTTSYKKSLQLSSDQIAKLKLQDGPNDVVFSITTQYQGTCRCAGTIYLWNWNDKVIISDIDGTIIKSD


Parental protein
ALGQILPQLGKDWTHQGIAKLYHSINENGYKFLYCSARAIGMADMTRGYLHWVNDKGTILPRGPLMLSPSSLFSAFHREVIEKKPEKFKIECLNDIKNLF
ALGQILPQLGKDWTHQGIAKLYHSIN.NG.KFLYCSA.AI..AD.T.GYLH.VNDKGTILPRGPLMLSPSSLFSAFHREVIEKKPEKFKIECLNDIKNLF
Retrocopy
ALGQILPQLGKDWTHQGIAKLYHSINKNGHKFLYCSACAISTADVTCGYLH*VNDKGTILPRGPLMLSPSSLFSAFHREVIEKKPEKFKIECLNDIKNLF


Parental protein
APSKQPFYAAFGNRPNDVYAYTQVGVPDCRIFTVNPKGELIQERTKGNKSSYHRLSELVEHVFPLLSKEQNSAFPCPEFSSFCYWRDPIPKVDLDDLA
APSKQPFYAAFGNRP.DVYAYTQVGVPDCRIFTVNPKGELIQERTKGNKS.YHRLSELVEHVFPLLSKEQNSA.PCPEFSSFCYWRDPIPKVDLDDLA
Retrocopy
APSKQPFYAAFGNRPSDVYAYTQVGVPDCRIFTVNPKGELIQERTKGNKSLYHRLSELVEHVFPLLSKEQNSACPCPEFSSFCYWRDPIPKVDLDDLA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide