RetrogeneDB ID:
retro_ecab_502
Organism:
Horse ( Equus_caballus )
Location:
2:96242437-96243544 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
73.78 %
Coverage:
56.06 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
PABPC4
Parental gene aliases:
No gene alias available
Parental gene description:
poly(A) binding protein, cytoplasmic 4 (inducible form) [Source:HGNC Symbol;Acc:8557]

Genomic region (view in browser)





>retro_ecab_502
ATGAATGTAGCAGCCAAGTACCGCCAGGCCTCCCTGTATGTGGGGGACCTCCATGCAGAT
GTCACCGAGGACCTGCTGTTCAAGAAATTCAGCACTGTGGGGCCCGTGCTGTCCATCCGC
ATCTGCAGGGACCTGGTCACCCGCCGCTCTCTGGGCTATGCCTATGTGAACTTCCTGCAG
CTGGCTGATGCCCAGAAGGCCCTGGACACAATGAACTTTGACACGATCAAAGGCAAATCC
ATCCGCCTCATGTGGTCTCAACGTGACGCCTACTTAAGGAAATCTGGGATTGGGAACGTG
TTCATCAAGAATCTGGACAAATCCATTGATAACAAAACCCTTTATGAACATTTTTCGGCC
TTTGGGAAGATCCTGTCCTCCAAGGTGATGAGCGATGACCAAGGCTCCAGGGGCTATGCG
TTTGTGCACTTTCAGAACCAGATGGCCGCAGATAGGGCCATCGAGGAGATGAACGGGGCG
CTGCTTAAGGACTGCAGGCTGTTTGTTGGCAGATTCAAAAACCGCCAAGATCGGGAAGCC
GAGCTCCAAAACAAAGCCAATGAATTCACCAATATTTACATCAAAAACTTTGGAGATGAC
ATGGATGATAAGAGACTGGAGGAAGTTTTCAGTAAATATGGCAAAACTGTGAGTGTTAAG
GTGATGACAGACTCCACTGGGAAATCCAAAGGCTTTGGCTTTGTGAGTTTTTATAGCCAC
GAGGCTGCCCAAAAGGCCGTGGAAGAAATGAATGGAAAGGATATAAACGGACAGCTGCTC
TTTGTAGGCCGGGCACAAAAGAAAGCAGAGCGACAGGCTGAATTAAAGCAAATGTTTGAG
CAGCAGAAACAGGAAAGATTTCGGCGGTGCCAGGGGGTGAAGCTCTACATTAAGAACCTC
GATGACACCATTGATGATGAAAAACTACGGAGGGAGTTTTCTTCCTTTGGATCAATTAGC
AGAGTCAAGGTGATGAAGGAAGAAGGGCGAAGCAAAGGCTTTGGCTTGATCTGCTTCTCC
TCTCCTGAAGAGGCCACCAGAGCAATGACTGAGATGAATGGCCGCATCTTGGGCTCCAAG
CCACTCAACATCGCCCTGGCGCAGAGG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.52
SRP021940_cerebellum 0.35
SRP021940_embryo 7.14
SRP021940_placental_villous 1.7
SRP021940_synovial_membrane 1.22
SRP021940_testis 0.53

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MNAAASSYPMASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPIRIMWSQRDPSLRKSGVGN
MN.AA..Y..ASLYVGDLH.DVTE..L..KFS..GPVLSIR.CRD..TRRSLGYAYVNF.Q.ADA..ALDTMNFD.IKGK.IR.MWSQRD..LRKSG.GN
Retrocopy
MNVAAK-YRQASLYVGDLHADVTEDLLFKKFSTVGPVLSIRICRDLVTRRSLGYAYVNFLQLADAQKALDTMNFDTIKGKSIRLMWSQRDAYLRKSGIGN


Parental protein
VFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYAFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKEFTNVYIKNFGE
VFIKNLDKSIDNK.LY..FSAFG.ILS.KV..D..GS.GYAFVHF..Q.AAD.AIE.MNG.LL.D...FVGRFK.R..REAEL..KA.EFTN.YIKNFG.
Retrocopy
VFIKNLDKSIDNKTLYEHFSAFGKILSSKVMSDDQGSRGYAFVHFQNQMAADRAIEEMNGALLKDCRLFVGRFKNRQDREAELQNKANEFTNIYIKNFGD


Parental protein
EVDDESLKELFSQFGKTLSVKVMRDPSGKSKGFGFVSYEKHEDANKAVEEMNGKEISGKVIFVGRAQKKVERQAELKRKFEQLKQERISRYQGVNLYIKN
..DD..L.E.FS..GKT.SVKVM.D..GKSKGFGFVS...HE.A.KAVEEMNGK.I.G...FVGRAQKK.ERQAELK..FEQ.KQER..R.QGV.LYIKN
Retrocopy
DMDDKRLEEVFSKYGKTVSVKVMTDSTGKSKGFGFVSFYSHEAAQKAVEEMNGKDINGQLLFVGRAQKKAERQAELKQMFEQQKQERFRRCQGVKLYIKN


Parental protein
LDDTIDDEKLRKEFSPFGSITSAKVMLEDGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQR
LDDTIDDEKLR.EFS.FGSI...KVM.E.GRSKGFG..CFSSPEEAT.A.TEMNGRI.GSKPL..ALAQR
Retrocopy
LDDTIDDEKLRREFSSFGSISRVKVMKEEGRSKGFGLICFSSPEEATRAMTEMNGRILGSKPLNIALAQR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide