RetrogeneDB ID:
retro_ecab_504
Organism:
Horse ( Equus_caballus )
Location:
2:103287161-103287770 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
59.43 %
Coverage:
77.53 %
Frameshifts:
3
Stop codons:
3


Parental gene:
Parental gene symbol:
AKTIP
Parental gene aliases:
No gene alias available
Parental gene description:
AKT interacting protein [Source:HGNC Symbol;Acc:16710]

Genomic region (view in browser)





>retro_ecab_504
CAGTAAACAAATGGCACACATGCTTTTTACAGACCCTTCCATCCGGAACACTCCCTTCTT
GCGGTATTTACCTTGCTTGTGAAGCAGAAGTTCTCTGGTGTCTATGTGCAGCCATCTTAT
AGCTCTTCATTAATGTAGGTCAGAGCAACATTCATATGCGATGGACTTTATCAAAGTGGC
ATATTTACATTTACAGTGTATATCACTGATAACTATCCAGATGGTGACTGTCCATGATGA
GGTTTGATCTGATGAGGTCTGTCTTTCACCCACTAGTTGATTCCAACGCAGGTCAACTAG
AGATGCAGAGAGCATTTGCAAAATGCAGGTGGAGCCATAAACATAGTTGTTAAGTATTTA
TGTATCCATGGGGAGTTGAAACAGCAAGACTCCTGAACCCAGAGTCTGCAGTACTGTATG
AAAAGATAGTCAACTTTTTAAAGTAAAATGCTTGACAGTATTGACATGCACTGCTTGCTT
GTTTGATAAATCTAAATTGGAAGACACTATGCAATTAGTTTTTCTCTGTGGAATTCTTCT
GTATGTGATGAACTCATAGAGATGATGCTATCTTATAGAAAGAAGACTGATGAACACCAT
AATAAAACA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QSTNGTHASYGPFYLEYSLLAEFTLVVKQKLPGVYVQPSYRSALMWFGVIFIRHGLYQDGVFKFTVYIPDNYPDGDCP-RLVFDI--PVFHPLVDPTSGE
Q.TNGTHA.Y.PF..E.SLLA.FTL.VKQK..GVYVQPSY.S.LM.....FI..GLYQ.G.F.FTVYI.DNYPDGDCP....FD....VFHPLVD...G.
Retrocopy
Q*TNGTHAFYRPFHPEHSLLAVFTLLVKQKFSGVYVQPSYSSSLM*VRATFICDGLYQSGIFTFTVYITDNYPDGDCP/MMRFDLMRSVFHPLVDSNAGQ


Parental protein
LDVKRAFAKWRRNHNHIWQVLMYARRVFYKIDTASPLNPEAAVLYE-KDIQLFKSKVIDSVKACTARLFDQPKIEDP-YAISFSPWNPSVHDEAREKMLT
L...RAFAK.R..H.H...V.MY.........TA..LNPE.AVLYE.KD.QLFK.K....V..CTA.LFD..K.ED..YAISFS.WN.SV.DE..E.ML.
Retrocopy
LEMQRAFAKCRWSHKHSC*VFMYP----WGVETARLLNPESAVLYE/KDSQLFKVKCL-TVLTCTACLFDKSKLEDT/YAISFSLWNSSVCDELIEMMLS


Parental protein
QKKKPEEQHNKS
..KK..E.HNK.
Retrocopy
YRKKTDEHHNKT


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide