RetrogeneDB ID:
retro_ecab_505
Organism:
Horse ( Equus_caballus )
Location:
2:107102344-107102760 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
54.23 %
Coverage:
55.29 %
Frameshifts:
1
Stop codons:
3


Parental gene:
Parental gene symbol:
SET
Parental gene aliases:
No gene alias available
Parental gene description:
SET nuclear oncogene [Source:HGNC Symbol;Acc:10760]

Genomic region (view in browser)





>retro_ecab_505
AAAAAAGCCAGTGAGGAAATTTTCAGAGTAGAACAAAAATGGCACAAACTCTTCAGTCTT
TTCAAAAGAGGTCATAACTTGGTCTCCCAATTCCCAAATTTAGAGGTGATGTTTGTTGAC
CATCTGCAAATGACTGCCCTCCTTGGGGATGCGCAAGAAGAGATGCTGAATTATTTTGTC
GGAACTGAAGTGACAGAATTTGAAGATTTTAAATCCTATTACAGAATAGGTTTTTAGTTT
GAGGAAAATTCTTACTTTAAAATAAAGTTCTTTCCAATACGTTTTATCTCAGTAAGAGTG
GCGACTCATCTTCCAAGTTGACTGAAATCAGATGGGAATCTGGGAAGGACTTGATAAAAT
GTTCTGATCAGACATAAAATAAACGTGTCTTGAAGAAGTAGCATGAAAACTCTGAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.52
SRP021940_cerebellum 0.05
SRP021940_embryo 0.12
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.26
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
EQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFE-NKILSKEFHL
..ASEEI..VEQK..KL....F.....L....PN..V..FV.H.Q..ALLG...EE.L.Y....EVTEFED.KS.YRI.F.F.EN.YF..NK.LS..F.L
Retrocopy
KKASEEIFRVEQKWHKLFS-LFKRGHNLVSQFPNLEVM-FVDHLQMTALLGDAQEEMLNYFVGTEVTEFEDFKSYYRIGF*FEENSYFK/NKVLSNTFYL


Parental protein
NESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPE
..SGD.SSK.TEI.W.SGKDL.K.S.QT.NK...K..HE..E
Retrocopy
SKSGDSSSKLTEIRWESGKDLIKCSDQT*NKRVLKK*HENSE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide