RetrogeneDB ID:
retro_ecab_506
Organism:
Horse ( Equus_caballus )
Location:
2:109880355-109881465 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
73.33 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
TRAM1
Parental gene aliases:
No gene alias available
Parental gene description:
translocation associated membrane protein 1 [Source:HGNC Symbol;Acc:20568]

Genomic region (view in browser)





>retro_ecab_506
ATGGCGTTCCGTAAGAAGAGCCCCAGGAACCCCCCAGTCCTGAGCCACGAATTCATCCTG
CAGAATCATGCAGACCTCGTCGCCTGCGTGGGGATGTTCTTCGTGCTGGGGCTCATGTTC
GAGGGAGCAGCAGAAGCATCTATCGTGTTTATTACTCTGCAGCACAGCGTTACCTTCCCC
GCGGCAGAAGAACCAGCCACGGACTTAAAGGTCCTTTATCATTATGGCATCAAAGATCTG
GCCACGGTTTTCTTCTACATGCTCGTGGCAATCATCATTCACGCCACCCTTCAGGAGTAT
GTGTTGGACAAAATTAACAGGCGAATGCAGTTTCCCAAAGCGAAACAAAGCAGATTTAAC
GAATCTGGTCAGTTGAGTGCATTCTACCTTGTCTCTTGTATTTGGGGCACGTTCATTCTG
ATCTCTGAAAACTGCCTGTCGGACCCCACTCTCTTATGGGAGGCGCATTACCATAACGTG
ATGACGTTTCAGATGAAGTTTTTCTATATCTCACAGTTGGCTTACTGGTTTCATGCCTTT
CCTGAACTCTACTTCCAGAGAACGAAAAAACAAGACATCCCCCGTCAGCTTGTCTACATT
GGGCTTCACCTCTTTCACATCGCCGGAGCCTATCTCCTGTACTTGAATCATCTGGGACTT
GTTCTCCTGATGATGCATTACTTTGTTGAATTACTTTCCCACATTTGCGACCTGTTTTAT
TTTAGTGATGAAAAGTACCAGAAAGACATTTCTCTGTGGGCAATTGTGTTTATTTTGGGT
CGACTTGTGACTTTAATTGTCTCCGTGCTCGCTGTGGGCTTTCACCTGGCTGGAGGGCAG
AATCGGAATCCCGATGCCGTCACCGGAAACGTGAATGTGTTGGCAGCCAAAATTGCCGTT
CTGTCGTCCAGTTGCACTATCCAAGCCTATATAACATGGAATTTATTTAATGTCCAGCTT
CAGAGGTGGATGGAAGAAGATGCTACTCTTCAGGCCCCAAGTGTGAAGAAGAAACGGACT
AAAGGCAGGTCTTCCAGAAAAGGAACAGAAAATGGGGTGGCAACGTCAAGTAGAGTAGAC
TCTCCGCATAAGAGGAAAGAGAAATCTTCA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 2.67
SRP021940_cerebellum 8.02
SRP021940_embryo 11.02
SRP021940_placental_villous 1.79
SRP021940_synovial_membrane 4.87
SRP021940_testis 1.72

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAIRKKSSKSPPVLSHEFILQNHADIVSCVAMVFLLGLMFEITAKASIIFVTLQYNVTLPATEEQATESASLYYYGIKDLATVFFYMLVAIIIHAIIQEY
MA.RKKS...PPVLSHEFILQNHAD.V.CV.M.F.LGLMFE..A.ASI.F.TLQ..VT.PA.EE.AT....LY.YGIKDLATVFFYMLVAIIIHA..QEY
Retrocopy
MAFRKKSPRNPPVLSHEFILQNHADLVACVGMFFVLGLMFEGAAEASIVFITLQHSVTFPAAEEPATDLKVLYHYGIKDLATVFFYMLVAIIIHATLQEY


Parental protein
VLDKINRRMHFSKTKHSKFNESGQLSAFYLFSCIWGTFILISENYISDPTILWRAYPHNLMTFQMKFFYVSQLAYWFHAFPELYFQKTKKEDIPRQLVYI
VLDKINRRM.F.K.K.S.FNESGQLSAFYL.SCIWGTFILISEN..SDPT.LW.A..HN.MTFQMKFFY.SQLAYWFHAFPELYFQ.TKK.DIPRQLVYI
Retrocopy
VLDKINRRMQFPKAKQSRFNESGQLSAFYLVSCIWGTFILISENCLSDPTLLWEAHYHNVMTFQMKFFYISQLAYWFHAFPELYFQRTKKQDIPRQLVYI


Parental protein
GLYLFHIAGAYLLNLNHLGLVLLVLHYFVEFLFHISRLFYFSDEKYQKGFSLWAVLFVLGRLLTLILSVLTVGFGLARAENQKLDFSTGNFNVLAVRIAV
GL.LFHIAGAYLL.LNHLGLVLL..HYFVE.L.HI..LFYFSDEKYQK..SLWA..F.LGRL.TLI.SVL.VGF.LA...N...D..TGN.NVLA..IAV
Retrocopy
GLHLFHIAGAYLLYLNHLGLVLLMMHYFVELLSHICDLFYFSDEKYQKDISLWAIVFILGRLVTLIVSVLAVGFHLAGGQNRNPDAVTGNVNVLAAKIAV


Parental protein
LASICITQAFMMWKFINFQLRRWREHSA-FQAPAVKKKPTVTKGRSSRKGTENGVNGTVTSNGADSPRNRKEKSS
L.S.C..QA...W...N.QL.RW.E..A..QAP.VKKK...TKGRSSRKGTENGV....TS...DSP..RKEKSS
Retrocopy
LSSSCTIQAYITWNLFNVQLQRWMEEDATLQAPSVKKKR--TKGRSSRKGTENGV---ATSSRVDSPHKRKEKSS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide