RetrogeneDB ID:
retro_ecab_508
Organism:
Horse ( Equus_caballus )
Location:
2:115823824-115824163 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
73.5 %
Coverage:
99.13 %
Frameshifts:
3
Stop codons:
0


Parental gene:
Parental gene symbol:
RPL30
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L30 [Source:HGNC Symbol;Acc:10333]

Genomic region (view in browser)





>retro_ecab_508
GTGGCCTCAAAGAAGTCAAAAAAGTCACTGGAGCTGATCAACTCTAGGCTCCAACTTATT
ATGAAAAGTAGAAAGTGCATGCTGAGATACAAGCAGACTCTGAAGACGATCAGACAAGGC
AAGCCAAACCGGTCATCCTTGCTAACAACCGCCCAGCCTTGAGGAAATGTGCAACAGAGC
ACTATGCCATGGTGGCCAAACTGGTGTCCATCACTACAGTGACATTAACACTGAATTGGG
CACAGTGTGTGGAAAATCCTACAGAGTATGCACACCAGTTGTCATTGATCCAGGTGGTTC
TGACATCTTTCAAAGCTGCCAGAACAGACTGGTGAAAAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VAAKKTKKSLESINSRLQLVMKSGKYVLGYKQTLKMIRQGK-AKLVILANNCPALRKSEIEYYAMLAK-TGVHHYSGNNIELGTACGKYYRVCTLAIIDP
VA.KK.KKSLE.INSRLQL.MKS.K..L.YKQTLK.IRQGK.AK.VILANN.PALRK...E.YAM.AK.TGVHHYS..N.ELGT.CGK.YRVCT...IDP
Retrocopy
VASKKSKKSLELINSRLQLIMKSRKCMLRYKQTLKTIRQGK/AKPVILANNRPALRKCATEHYAMVAK/TGVHHYSDINTELGTVCGKSYRVCTPVVIDP


Parental protein
GDSDIIRS-MPEQTGEK
G.SDI..S..PEQTGEK
Retrocopy
GGSDIFQS/LPEQTGEK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide