RetrogeneDB ID:
retro_ecab_510
Organism:
Horse ( Equus_caballus )
Location:
2:13006808-13007382 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
77.04 %
Coverage:
99.48 %
Frameshifts:
4
Stop codons:
0


Parental gene:
Parental gene symbol:
GM2A
Parental gene aliases:
No gene alias available
Parental gene description:
ganglioside GM2 activator [Source:RefSeq peptide;Acc:NP_001075381]

Genomic region (view in browser)





>retro_ecab_510
AGACCCTCGATGCAGGCTCCATTCCTGATCGCCGTGGGCTTGCTTCTTGCTGGCCCTGCG
GCTCCTGTAAGCATCCTCCTAGACAGCTCAGTAGATTTTCCTGGGTAACTGTGATGAGGG
GAAGGATCCTGTGGTGATCAAAACCCTGACTGTGGAACCTGACCCCATTGCTGTTCCTGG
AAACGTGACTGTCAGTGCCGAGGTAAAGACCACTGTCCCCTTCATTGCTCCTCAGAAGGT
GGAAATAACTCTGGATAAGGAAGTGGCCAGTGTATGGGTCAAAATCCCGTGTATGGAACA
AATCGGTAGCTGTACATTTGACAATGCCTATGATATGCTTGACACTTAAGACTCCCCCTG
GGCAATCCTGCCCAGAGCCCCTGCACACCTATGGGCTTCCTTGTCGCTGTCCCTTCAAAG
AAGCCACCTACTCATTGCCCAAGAGTACTTTCCCCTCCCCAACCTGGAGCTGCCCAGCTG
GCTCAACAACAGGAACTACCGCATCCAGAGCGTCCTGAGCGGCAGTGGGACTCGTCTGGG
CTGTATCAAGATCTCCACCTCTCTAAAGGGCAAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.2
SRP021940_embryo 0.24
SRP021940_placental_villous 0.04
SRP021940_synovial_membrane 0.08
SRP021940_testis 1.19

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RPSMQAPFLIALGLLLAGPAAPVSVLSE-RLRSFSW-DNCDEGKDPMVLKSLTLEPDPIAVPGNVTVSAEVKTTVALSAPQKVELTVEKEVAGVWVKIPC
RPSMQAPFLIA.GLLLAGPAAPVS.L....L..FSW..NCDEGKDP.V.K.LT.EPDPIAVPGNVTVSAEVKTTV...APQKVE.T..KEVA.VWVKIPC
Retrocopy
RPSMQAPFLIAVGLLLAGPAAPVSILLD/QLSRFSW/GNCDEGKDPVVIKTLTVEPDPIAVPGNVTVSAEVKTTVPFIAPQKVEITLDKEVASVWVKIPC


Parental protein
VDQIGSCTFDNACDILDA-LTPPGQPCPEPLHTFGLPCHCPFKEGTYSLPKST-FPLPDLELPSWLSNGNYRVQSILSSGGKRLGCVKITASLKAK
..QIGSCTFDNA.D.LD...TPPGQ.CPEPLHT.GLPC.CPFKE.TYSLPKST.FPLP.LELPSWL.N.NYR.QS.LS..G.RLGC.KI..SLK.K
Retrocopy
MEQIGSCTFDNAYDMLDT\KTPPGQSCPEPLHTYGLPCRCPFKEATYSLPKST/FPLPNLELPSWLNNRNYRIQSVLSGSGTRLGCIKISTSLKGK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide