RetrogeneDB ID:
retro_ecab_511
Organism:
Horse ( Equus_caballus )
Location:
2:18488142-18489687 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
74.13 %
Coverage:
99.62 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
OXCT1
Parental gene aliases:
No gene alias available
Parental gene description:
Succinyl-CoA:3-ketoacid-coenzyme A transferase [Source:UniProtKB/TrEMBL;Acc:F7A396]

Genomic region (view in browser)





>retro_ecab_511
ATGGCGGGCCTAGTGGTACTCTCGGCGGCGCTCGGGCGCCGCGTCTCTACCGGTCGCTCG
GGGCGCGCGCTGGCCGAGGGCGGGGTGTGCGGCTTCGCCAGCAGCGCTCGCGCCCGCGCC
CGGTTCTACACGGATCCCGTGGAGGCGGTGAGAGACATCGCCGACGGGGCGAAGATCATG
GTCGGGGGCTTCGGGCTCTGTGGGATTCCGGAGAACCTGATCCGGGCGCTGCTCAAGACC
CGCGTGAGAGACTTGACCGTGGTCAGCAGCAACGTGGGGGTGGACGACTTCGGGCTGGGC
CTGCTGCTGGGGACCAAGCAGATCACCCGCATCATCTGCTCTTACGCGGGAGAGAACGCG
CTGTGCGAGCAGCAGTACCTGGCGGGCGAGCTGGAGCTGGAGCTGACGCCCCAGGGCACC
CTGGCCGAGCGCATCCGCGCCGGCGGGGCCGGAGTGCCCGCCTTCTACACGCCCACGGCC
TACGGGACCCTGGTGCAGGAAGGCGGCGCCCCCATCAGGTACTTCCAGGACGGCCACATC
GCCATCCTGAGTCAGCCGAGAGAGGTGCGGGAGTTCCACGGGCACCACTACCTCCTGGAG
CACGCCATCACGGCGGATTTCGCTTTGGTCAAAGGGTGGAAGGCCGACCGCGCAGGAAAC
GTCATCTTCAGGCGAAGCGCCAGGAATTTCAACGTGCCCATGTGCAAAGCTGCGAACACC
TCGGTGGTCGAAGTTGAAGAAATTGTGGATGTGGGGTCGTTTGCCCCAGAAGACATCCAT
GTTCCTAACATTTATGTAGATCGCGTCATCCAGGGGGAGAAATATGAGAAAAGAATTGAG
CGTTTAACAATCCGGAAGGAGGAAAGTGGAAAAGCCAAGGCTGCCGAGGATATAAGAACA
TGGATCATCAAGCGGGCGGCTCTCGAATTTGAGGATGGCATGTATGCCAATCTGGGCATA
GGCATCCCTCTTCTGGCCAGCAACTACATCAGCCCGAATATAACCGTCCACCTTCACAGC
GAGAACGGCATCCTGGGCTTGGGTCCGTTCCCACGGAAAGACCAGGTGGATGCAGACCTC
ATCAATGCCGGCAAGCAAACCGTCACCATTTTCCCCGGGGGCTGTTTCTTCTCCAGCGAT
GACTCGTTTGCCATGATCCGAGGGGGACACATCCACCTCACCATGCTGGGAGCCATGCAG
GTGTCCAAATACGGCGACCTGGCCAACTGGATGATCCCCGGAAAGAGGGTGAAGGGCATG
GGGGGTGCGATGGATTTGGTGTCCAGTGCCAAGACCAGGGTGGTGGTCACCATGGAGCAC
TCCACCAAGGCCAACGAACCCAAAATCTTGGAGAAATGCACGATGCCCCTGACCGGGAAG
CGGTGCGTGGACCGAGTCATCACGGAGAGGGCCGTGTTTGACGTGGACAAGAAGAGAGGG
CTGACGCTGACCGAGCTCTGGGAAGGCCTGACGGTGGAGGACATCAGGAAGAGCACGGGG
AGCACCTTCGCCGTCTCCCCCGATCTCAGACCCATGCAGCAGGTG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 3.19
SRP021940_cerebellum 13.14
SRP021940_embryo 0.48
SRP021940_placental_villous 1.83
SRP021940_synovial_membrane 0.73
SRP021940_testis 356.31

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAALKLLSSWQRPWASARGSGGAWLKGCVCYFSTSTRHHTKFYTDPVEAVKDIPDGATVLVGGFGLCGIPENLIGALLKTGVKGLTAVSNNAGVDNFGLG
MA.L..LS.......S...SG.A...G.VC.F..S.R....FYTDPVEAV.DI.DGA...VGGFGLCGIPENLI.ALLKT.V..LT.VS.N.GVD.FGLG
Retrocopy
MAGLVVLSAALGRRVSTGRSGRALAEGGVCGFASSARARARFYTDPVEAVRDIADGAKIMVGGFGLCGIPENLIRALLKTRVRDLTVVSSNVGVDDFGLG


Parental protein
LLLRSKQIKRMVSSYVGENAEFERQYLAGELEVELTPQGTLAERIRAGGAGVPAFYTSTGYGTLVQEGGSPIKYNTDGSIAIASKPREVREFNGQNFILE
LLL..KQI.R...SY.GENA..E.QYLAGELE.ELTPQGTLAERIRAGGAGVPAFYT.T.YGTLVQEGG.PI.Y..DG.IAI.S.PREVREF.G....LE
Retrocopy
LLLGTKQITRIICSYAGENALCEQQYLAGELELELTPQGTLAERIRAGGAGVPAFYTPTAYGTLVQEGGAPIRYFQDGHIAILSQPREVREFHGHHYLLE


Parental protein
EAITGDFALVKAWKADRAGNVIFRKSARNFNLPMCKAAETTVVEVEEIVDIGSFAPEDIHIPKIYVHRLIKGEKYEKRIERLSVRKEGDVKAKSGKPGDN
.AIT.DFALVK.WKADRAGNVIFR.SARNFN.PMCKAA.T.VVEVEEIVD.GSFAPEDIH.P.IYV.R.I.GEKYEKRIERL..RKE...KAK.......
Retrocopy
HAITADFALVKGWKADRAGNVIFRRSARNFNVPMCKAANTSVVEVEEIVDVGSFAPEDIHVPNIYVDRVIQGEKYEKRIERLTIRKEESGKAKA---AED


Parental protein
VRERIIKRAALEFEDGMYANLGIGIPLLASNFISPDMTVHLQSENGILGLGPYPLQNEVDPDLINAGKETVTVLPGAAYFSSDESFAMIRGGHVNLTMLG
.R..IIKRAALEFEDGMYANLGIGIPLLASN.ISP..TVHL.SENGILGLGP.P....VD.DLINAGK.TVT..PG...FSSD.SFAMIRGGH..LTMLG
Retrocopy
IRTWIIKRAALEFEDGMYANLGIGIPLLASNYISPNITVHLHSENGILGLGPFPRKDQVDADLINAGKQTVTIFPGGCFFSSDDSFAMIRGGHIHLTMLG


Parental protein
AMQVSKYGDLANWMIPGKMVKGMGGAMDLVSSARTKVVVTMEHSAKGNTHKILEKCTLPLTGKQCVNRIITEKAVFDVDNKKGLTLIELWEGLTVDDIKK
AMQVSKYGDLANWMIPGK.VKGMGGAMDLVSSA.T.VVVTMEHS.K.N..KILEKCT.PLTGK.CV.R.ITE.AVFDVD.K.GLTL.ELWEGLTV.DI.K
Retrocopy
AMQVSKYGDLANWMIPGKRVKGMGGAMDLVSSAKTRVVVTMEHSTKANEPKILEKCTMPLTGKRCVDRVITERAVFDVDKKRGLTLTELWEGLTVEDIRK


Parental protein
STGCDFAVSPKLMPMRQI
STG..FAVSP.L.PM.Q.
Retrocopy
STGSTFAVSPDLRPMQQV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide