RetrogeneDB ID:
retro_ecab_512
Organism:
Horse ( Equus_caballus )
Location:
2:22083803-22084409 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
77.67 %
Coverage:
93.52 %
Frameshifts:
3
Stop codons:
3


Parental gene:
Parental gene symbol:
RPL10A
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L10a [Source:HGNC Symbol;Acc:10299]

Genomic region (view in browser)





>retro_ecab_512
GAAGTCCTGCACCAGAACCTGCCCAGCGCCAGAAGTTTTGGAAGCAGTGGAGCTGCAGAT
CATCTTGAAGAACTATGACCCTCAGAAGGACAAATGCTTTTCCAGCACCGTCAGGCTTAA
GTCCACTCCCTGCCCCAAATTCCCCATGTGTGCCCTGGGGGACCAGCAGCACTGTGATGA
GGCCAAGGCTGTGGATATCCCCCACATGGGCATTGAGGCACTGAAGAAACTTGACAAGAA
TGAGAAGCTGGTCAAGAAGTTGGCCAAAAAGGATGACCCCTTTTAGGCTTCAGAGTCTCT
GGTCAAGCAGATCCCATGAATCCTGGGCCCAGGCCTGAATAAAGCTGACAAGTTCCCGTC
CTCGCTGACTGACAATGAGAATATGGTGGCCGAAGTTGATGAAGTGAAGTCCATGATTAA
GTCCCAGATGAAGAAGAAGTTGCTGTGTCTAGCAGTGGATGTTGGCTACTTAAGATGACA
GATAATGAGCTTGTGTGAAACATCCACTTAGCTGTCAGTTTCCTGGTGTCATGGCTCAAG
AATAACTGCCAGAAGGTCCAGGCTTTATACGTCAAGAGCACCATGAGCAAGCCCCAATGT
CTGTAC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.23
SRP021940_cerebellum 0.0
SRP021940_embryo 0.02
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
EVLHGN-QRKRSKF-LETVELQISLKNYDPQKDKRFSGTVRLKSTPRPKFSVCVLGDQQHCDEAKAVDIPHMDIEALKKLNKNKKLVKKLAKKYDAFLAS
EVLH.N....R.KF.LE.VELQI.LKNYDPQKDK.FS.TVRLKSTP.PKF..C.LGDQQHCDEAKAVDIPHM.IEALKKL.KN.KLVKKLAKK.D.F.AS
Retrocopy
EVLHQN/PAQRQKF/LEAVELQIILKNYDPQKDKCFSSTVRLKSTPCPKFPMCALGDQQHCDEAKAVDIPHMGIEALKKLDKNEKLVKKLAKKDDPF*AS


Parental protein
ESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIKFQM-KKVLCLAVAVGH-VKMTDDELVYNIHLAVNFLVSLLKKNWQNVRALYIKSTMG
ESL.KQIP.ILGPGLNKA.KFPS.LT.NENMVA.VDEVKS.IK.QM.KK.LCLAV.VG...KMTD.ELV.NIHLAV.FLVS.LK.N.Q.V.ALY.KSTM.
Retrocopy
ESLVKQIP*ILGPGLNKADKFPSSLTDNENMVAEVDEVKSMIKSQMKKKLLCLAVDVGY/LKMTDNELV*NIHLAVSFLVSWLKNNCQKVQALYVKSTMS


Parental protein
KPQRLY
KPQ.LY
Retrocopy
KPQCLY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide