RetrogeneDB ID:
retro_ecab_514
Organism:
Horse ( Equus_caballus )
Location:
2:41273530-41273845 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
79.44 %
Coverage:
80.15 %
Frameshifts:
2
Stop codons:
3


Parental gene:
Parental gene symbol:
RPS24
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S24 [Source:HGNC Symbol;Acc:10411]

Genomic region (view in browser)





>retro_ecab_514
AATGACACAGTCACTATCTGAACCAGGAAGTTCATGACCAATCGACTACTTCAGTGGAAA
CAAATGGTTATCAATGTCCTTCACCCTGGGAAGGCAACAATACCTAACACAGAAATTCCG
GGAAAATGAGCCAAAATGTACAACACCACACCACATGTCATCTTTGTATTTGGATTCAGA
GACCATTTTGGTGTATGGCAAGACAACTGGCTTCAGCAGGATTTATGATTTCTTGGAATA
TGCAAAGAAAAATGAACCGAACCTTGACTTGCAAGACATGGCCTGTATGAGAACAAAAAG
ACCTCAAGAAAACAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.03
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
NDTVTIRTRKFMTNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTHFG-GGKTTGFGMIYDSLDYAKKNEP-KHRLARHGLYEK
NDTVTI.TRKFMTNRLLQ.KQMVI.VLHPGKAT.P.TEI..K.AKMY.TTP.VIFVFGFR.HFG..GKTTGF..IYD.L.YAKKNEP....LARHGLYE.
Retrocopy
NDTVTI*TRKFMTNRLLQWKQMVINVLHPGKATIPNTEIPGK*AKMYNTTPHVIFVFGFRDHFG\YGKTTGFSRIYDFLEYAKKNEP/EP*LARHGLYEN


Parental protein
KKTSRKQ
KKTSRKQ
Retrocopy
KKTSRKQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide