RetrogeneDB ID:
retro_ecab_516
Organism:
Horse ( Equus_caballus )
Location:
2:61577889-61578994 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
67.02 %
Coverage:
62.29 %
Frameshifts:
4
Stop codons:
5


Parental gene:
Parental gene symbol:
SSRP1
Parental gene aliases:
No gene alias available
Parental gene description:
structure specific recognition protein 1 [Source:HGNC Symbol;Acc:11327]

Genomic region (view in browser)





>retro_ecab_516
CTTACAAGCAAGGCCTTTGACTACAAGATCTCCTACACTTCAGTACCTAATCTCTTTTTG
TTGCGTCACAAGGACCATCACCAGATATTCTTTGTGATCAGGCTGTATCCCTCCATCAAG
CAGGGCAAAACCTGGTACCGCTTCCTGATCCTCCTTTTCTCCAAGGACAAGGACATTTCC
TTGACTTCCAACAAGAACAAGGAAGAAATGGAGAAGCACTTTGATAGGCAGTTCACTAAG
AACATGTTGGGATCCCTCCAAGAGATGGTTGGCCAAGTCATGAAAGCATTGGTGAACCAC
AAGGTCACACTCCCAGGCAACTTCCAAGGACATTTAGGGGCCCAGTGTTTCACTTGCTCC
TACAAGGTGAGCTCAGGACTGCTCTACCTGCTCAGTGGGGCTTCATCTAGGTTCACAAGC
CACCCAGACAGATCTGCTTTGACAAAATCTCTTTCATCAACTTTGCCAATGGCACCACTG
CCACTTGCTCCTTTGACTTTGAAATTGAGACCAAGCAGGCACTCAGTATACCTTCGGCAG
CATTGAGAGGGAGGAGTATGAGAAACCATTTGATTTTGTCAATGCAAAAAAGCTCAACAT
CAAAAACCAAATATTAAAAGAGAAGATGAACCAAAACTACAATGAATAGGCCTCTAACTC
TGATGAAGATGAGTGTGATGTCTTCATGGAACTGATAAAAGATGCCTGCTTAGAGAATGC
CACCAAAAACTATAGTGACTCAGGAGAATAAACTGATAAGTCATTCTAGTCAGGTGGAGA
AAAGCAGGAAATGGCAGAGAAGTTTAACAGTAACGCCTCTGCCAGCCAGCTCTTCCAGTA
ATGATGGTGACAGTGATTGGGATGAGACGAAGAGAAAACAGCTCAAAACAGCTGAAACAG
TCAAGGATCACAATGGTCTCAAGAAGTCTGTGGAGGTGGAGAAGGGCAAAGTCCTCAATG
CCCCCAAAAGGCACATGTCTGCATACATGCTGTGCTCAATGCTACTTGAGAGAAGATCAA
GCCTGCCCATCTTGGCATCAGTATCATGGATATTTCCAAGAAGGCATACAAGATCTGGAA
GGGGATGCCCAAGGAGAAGAAAGAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.05
SRP021940_embryo 0.02
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.03
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LHGKTFDYKIPYTTVLRLFLLPHKDQRQMFFVISLDPPIKQGQTRYHFLILLFSKDEDISLTLNMNEEEVEKRFEGRLTKNMSGSLYEMVSRVMKALVNR
L..K.FDYKI.YT.V..LFLL.HKD..Q.FFVI.L.P.IKQG.T.Y.FLILLFSKD.DISLT.N.N.EE.EK.F....TKNM.GSL.EMV..VMKALVN.
Retrocopy
LTSKAFDYKISYTSVPNLFLLRHKDHHQIFFVIRLYPSIKQGKTWYRFLILLFSKDKDISLTSNKNKEEMEKHFDRQFTKNMLGSLQEMVGQVMKALVNH


Parental protein
KITVPGNFQGHSGAQCITCSYKASSGLLY-PLERGFIYVHKPPVHIRFDEISFVNFARGTTTTRSFDFEIETKQ-GTQYTFSSIEREEYGKLFDFVNAKK
K.T.PGNFQGH.GAQC.TCSYK.SSGLLY.P...GFI.VHKPP..I.FD.ISF.NFA.GTT.T.SFDFEIETKQ.GTQYTF.SIEREEY.K.FDFVNAKK
Retrocopy
KVTLPGNFQGHLGAQCFTCSYKVSSGLLY/PAQWGFI*VHKPPRQICFDKISFINFANGTTATCSFDFEIETKQ/GTQYTFGSIEREEYEKPFDFVNAKK


Parental protein
LNIKNRGLKEGMNPNYDEYA-DSDEDQHDAYLERMKEEGKIREENANDSSDDSGEETDESFNPGEEEEDVAEEFDSNASAS-SS-SNEGDSDRDEKKRKQ
LNIKN..LKE.MN.NY.E.A..SDED..D...E..K......E......SD.SGE.TD.SF..G.E....AE.F.SNASAS.SS.SN.GDSD.DE.KRKQ
Retrocopy
LNIKNQILKEKMNQNYNE*ASNSDEDECDVFMELIKD--ACLENATKNYSD-SGE*TDKSF*SGGEKQEMAEKFNSNASAS\SSSSNDGDSDWDETKRKQ


Parental protein
LKKAKMAKDRKSRKKPMEVKKGKDPNAPKRPMSAYMLW-LNASREKIKSDHPGISITDLSKKAGEIWKGMSKEKKE
LK.A...KD....KK..EV.KGK..NAPKR.MSAYML..LNA..EKIK..H.GISI.D.SKKA..IWKGM.KEKKE
Retrocopy
LKTAETVKDHNGLKKSVEVEKGKVLNAPKRHMSAYMLC/LNAT*EKIKPAHLGISIMDISKKAYKIWKGMPKEKKE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide