RetrogeneDB ID:
retro_ecab_52
Organism:
Horse ( Equus_caballus )
Location:
28:15584077-15585814 (-)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
60.39 %
Coverage:
99.34 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
GALNT12
Parental gene aliases:
No gene alias available
Parental gene description:
UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 12 (GalNAc-T12) [Source:HGNC Symbol;Acc:19877]

Genomic region (view in browser)





>retro_ecab_52
ATGGCCGTGAGGTGGACCTGGGCTGGCAAAAGCTGCCTGCTGCTGGCGCTTTTAACGGTG
GCCTATATCCTGGTGGAAGTCTCGGTCTCCACTTTCCATGCCTCCCCGGGAACCGGCCTG
GCCAGGGATTGGGGATCAAGACAGATCTCCGACCCTGGGGACAAGGCAGAGGATTTGTCT
CGACCGCTTTATGAGAAGCCCCCTGCGGATTCCCATGCACTTGGGGAGTGGGGGAAAGCC
AGCAAACTCCAGCTCAACGAGGGGGAACTGAAGCAGCAAGAAGAACTCATTGAGAGATAT
GCCATTAATATTTACCTCAGTGACAGGATCTCCCTCCACCGCCACATAGAGGATAAAAGA
ATGTATGAGTGTAAATCCCAGAAGTTCAACTATAGGAAACTTCCCACCACGTCTGTTGTT
ATTGCTTTTTATAATGAAGCCTGGTCGACTCTGCTCCGCACCATCCACAGTGTTCTAGAA
ACTTCTCCTGCAGTCCTTTTGAAGGAGATCATCTTAGTCGATGACTTGAGTGACAGAGTT
TATTTGAAGACACAACTTGAAACTTATATCAGCAATCTTGATAGAGTCCGCTTGATTAGA
ACAAATAAGCGAGAGGGGCTGGTCAGGGCCCGTCTGATTGGGGCCACTTTTGCCACTGGG
GATGTCCTCACTTTCTTGGATTGTCACTGTGAGTGTAATTCTGGTTGGTTGGAACCACTT
TTGGAAAGGATCAGTAAAGATGAAACGGCAGTTGTGTGTCCTGTCATAGACACCATTGAT
TGGAATACTTTTGAATTCTATATGCAGACTGGGGAGCCCATGATTGGTGGTTTTGACTGG
CGTTTAACGTTCCAGTGGCATTCTGTCCCCAAACATGAAAGGGACAGGCGGAAATCGAGA
ATTGACCCAATCAGTTCACCCACCATGGCTGGAGGACTGTTTGCTGTCAGCAAGAAGTAT
TTTGAGTACCTTGGAACATATGACACTGGAATGGAAGTGTGGGGAGGTGAAAACCTCGAG
CTGTCTTTTAGGGTGTGGCAGTGTGGAGGTAAATTGGAGATCCACCCCTGTTCCCACGTG
GGCCATGTATTCCCGAAACGGGCACCGTATGCTCGGCCCAATTTCCTCCAGAATACTGCC
CGGGCAGCAGAAGTGTGGATGGACGAGTACAAAGAGCATTTCTACAATCGGAACCCTCCA
GCACGGAAAGAAGCTTATGGTGATATTTCTGAAAGAAAATTACTACGAAAACGACTGAAG
TGCAAGAGCTTTGACTGGTATTTGAAAAATGTGTTTTCTAATTTGCACGTTCCGGAGGAT
AGGCCAGGCTGGCACGGAGCTATTCGCAGTATGGGGATCCCTTCTGAATGTTTAGATTAT
AATGCTCCTGACAACAACCCTACAGGTGCTAACCTTTCACTGTTTGGATGCCATGGTCAA
GGCGGCAATCAATTCTTTGAATATACTTCAAAGAAAGAAATAAGGTTTAATTCTGTGACG
GAGTTATGTGCAGAGGTTCCTGAGCAAAAAAACCATGTAGGAATGCAAAATTGTCCAAAA
GATGGGTTCTCTATTCCAGCAAACATTATTTGGCATTTTAAAGAAGATGGAACCATTTTT
CATCCACACTCAGGACAGTGCCTTAGCGCTTATTGGACACCTGAGGGCCGACCGAATGTT
GAAATGAGAACTTGTCGTGCTCTAGCTAAAAATCAAATCTGGAAGTTTGAGAAATAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 2.03
SRP021940_cerebellum 0.55
SRP021940_embryo 2.68
SRP021940_placental_villous 9.93
SRP021940_synovial_membrane 6.56
SRP021940_testis 3.56

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
CKKKTYDYERLPTTSVVIAFYNEAWSTLLRTVYSVLETSPDILLEEVILVDDYSDREHLKERLASELSRLPKVRLIRANKREGLVRARLLGASAAKGDVL
CK.....Y..LPTTSVVIAFYNEAWSTLLRT..SVLETSP..LL.E.ILVDD.SDR..LK..L....S.L..VRLIR.NKREGLVRARL.GA..A.GDVL
Retrocopy
CKSQKFNYRKLPTTSVVIAFYNEAWSTLLRTIHSVLETSPAVLLKEIILVDDLSDRVYLKTQLETYISNLDRVRLIRTNKREGLVRARLIGATFATGDVL


Parental protein
TFLDCHCECHEGWLEPLLQRIHEEESAVVCPVIDVIDWNTFEYLGNSGEPQIGGFDWRLVFTWHVVPERERLRMRSPTDVIRSPTMAGGLFAVSKKYFEY
TFLDCHCEC..GWLEPLL.RI...E.AVVCPVID.IDWNTFE.....GEP.IGGFDWRL.F.WH.VP..ER.R..S..D.I.SPTMAGGLFAVSKKYFEY
Retrocopy
TFLDCHCECNSGWLEPLLERISKDETAVVCPVIDTIDWNTFEFYMQTGEPMIGGFDWRLTFQWHSVPKHERDRRKSRIDPISSPTMAGGLFAVSKKYFEY


Parental protein
LGSYDTGMEVWGGENLEFSFRIWQCGGTLETHPCSHVGHVFPKQAPYSRSKALANSVRAAEVWMDGYKELYYHRNPHARLEPFGDVTERKQLREKLRCKD
LG.YDTGMEVWGGENLE.SFR.WQCGG.LE.HPCSHVGHVFPK.APY.R...L.N..RAAEVWMD.YKE..Y.RNP.AR.E..GD..ERK.LR..L.CK.
Retrocopy
LGTYDTGMEVWGGENLELSFRVWQCGGKLEIHPCSHVGHVFPKRAPYARPNFLQNTARAAEVWMDEYKEHFYNRNPPARKEAYGDISERKLLRKRLKCKS


Parental protein
FRWFLENVYPELHVPEDRPGCFGMLQNKGLKDYCFDYNPPNENQITGHQVTLYLCHGMGQNQFFEYTSRNEIRYNTRQPEGCVAVDAGTDILTMHLCKE-
F.W.L.NV...LHVPEDRPG..G.....G....C.DYN.P..N..TG....L..CHG.G.NQFFEYTS..EIR.N....E.C..V........M..C...
Retrocopy
FDWYLKNVFSNLHVPEDRPGWHGAIRSMGIPSECLDYNAPDNNP-TGANLSLFGCHGQGGNQFFEYTSKKEIRFNS-VTELCAEVPEQKNHVGMQNCPKD


Parental protein
--VAPENQKFILQDDGSLFHIQSKKCVQAERKASGDSFVPLLRDCTDSDHQRWFFKE
....P.N.......DG..FH..S..C..A.....G...V...........Q.W.F..
Retrocopy
GFSIPANIIWHFKEDGTIFHPHSGQCLSAYWTPEGRPNVEMRTCRALAKNQIWKFEK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide