RetrogeneDB ID:
retro_ecab_520
Organism:
Horse ( Equus_caballus )
Location:
2:69721891-69722242 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
81.2 %
Coverage:
80.14 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
MGST2
Parental gene aliases:
No gene alias available
Parental gene description:
microsomal glutathione S-transferase 2 [Source:HGNC Symbol;Acc:7063]

Genomic region (view in browser)





>retro_ecab_520
ATGGCTGGGAATTCAATCTTGCTGGCTGCTGTCTCTGTCTTCCCTGTCTGTCAGCAAAGT
TATTTTGCTTTGCAGGTAGGAAAGGCAAGATTAAAATACAAAATTATGCCCTTGGCAGTC
TCTGGGTCACCAGAGTTTGACAGAATATTTCATGCACAACAAAACTATGGGGAGTTTTAC
CCCACAGTCGTGATTACATTGTGGATGGCCGGATGGTATTTCAATCAAGTTTTTGCTACT
TTTCTGGGTCAGCTGTACCTCTATGCCCATCACCAGTATATCTGGGGATATTCAGAAGCT
GCTAACAAAAGGGTCACTGGTTTCGGGTTGAGTCTGGGGATTTTGGCCGTT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAGNSILLAAVSLLSACQQSYFAFQVGRARLKYKIMPPAVSGSPEFDRIFRAQQNSVEFYPAFMITLWMAGWYFNQVFATCLGLLYIYARHQYFWGYSEA
MAGNSILLAAVS....CQQSYFA.QVG.ARLKYKIMP.AVSGSPEFDRIF.AQQN..EFYP...ITLWMAGWYFNQVFAT.LG.LY.YA.HQY.WGYSEA
Retrocopy
MAGNSILLAAVSVFPVCQQSYFALQVGKARLKYKIMPLAVSGSPEFDRIFHAQQNYGEFYPTVVITLWMAGWYFNQVFATFLGQLYLYAHHQYIWGYSEA


Parental protein
ANKRMTGFRLGLGILAL
ANKR.TGF.L.LGILA.
Retrocopy
ANKRVTGFGLSLGILAV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide