RetrogeneDB ID:
retro_ecab_525
Organism:
Horse ( Equus_caballus )
Location:
2:101381817-101382114 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
66.67 %
Coverage:
98.98 %
Frameshifts:
0
Stop codons:
1


Parental gene:
Parental gene symbol:
TAF10
Parental gene aliases:
No gene alias available
Parental gene description:
TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa [Source:HGNC Symbol;Acc:11543]

Genomic region (view in browser)





>retro_ecab_525
CAGTTGGAGGACTGCACACCTACAATCCCAGATAGAGTGACTGGCTACTCCCTGAACCAT
GCTGGCTTTGGAGCCTCAGATCCAGACATAACTCAGTTCATCCCCCTAACTGCTCAGAAA
TTCATCTCAGATATCGCCAACAATGTTGATGTCCTGTGGCACTGCAAAAGGAAGGGCACA
GCTTCTAGCAGCTCCTGAAGCAAGAAAAGGGACCACAGGTACACTCTAAGCATAGAGGAC
TTGACTTCTACCCTTAGCAAGTATGACATCAGTATAAACAAACCACAACACTTCACC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIAN--DALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKPHYFT
QLED.TPTIPD.VTGY.LN.AGF.ASDP.I...I.L.AQKFISDIAN..D.L.HCK.KGTAS.SS.SK..D..YTL..EDLT..LS.Y.I...KP..FT
Retrocopy
QLEDCTPTIPDRVTGYSLNHAGFGASDPDITQFIPLTAQKFISDIANNVDVLWHCKRKGTASSSS*SKKRDHRYTLSIEDLTSTLSKYDISINKPQHFT


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide