RetrogeneDB ID:
retro_ecab_528
Organism:
Horse ( Equus_caballus )
Location:
2:112845580-112846199 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
58.02 %
Coverage:
92.41 %
Frameshifts:
3
Stop codons:
4


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_ecab_528
AACAGCAGAGCAGATGATACAAAAGAATGAATCAGTGAGTTGGACAAAAGAGCAGAGGAA
ATCACCAAAGCCAAACAGAAAAAAGAAAAAATAATGAAAAAGAATGAGAACAGTATAAGG
GACTTCTGGGACAACATCAAGCATAGTAACATCCACCTTATAGGTGTCCCAGAAGGTGAA
GAGGAAGACAAAGGGGCTGAAAAATTATTTGAATAATAGCTGAAAACTTCCCTAACCAGG
AGAAGGAAACAGACATCCAGGTACAGGAAGCACAGAGAGTACCAAACAAGAGGAACCCAA
AGAGGCCCACACCAAGACACATTATAATTAAAATGTAAAGAATTAAAGTTAAAGAGAGAA
TCCTAAAAGCTGCAAGAGAAAAGCAACAAATTACATACAAAGGAAATTCCATAAGGCTAT
CAGCTGACTTTTCAGCAAAAACTTCACAGGCTAGAAGGGAGGCACGATATATTCAAAGTG
CTGAAAGGAAAAAATCTGCAACCAAGAATACCCAGCAAGGTTATCATTCAGAATGGAAAG
AGATAAAGAGCTTTCCAAATAGCAAAAACTAAAGGGGTTCATCACCACTAAACTGGTATT
ATAAGCAATGTTAAAGGGG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.65
SRP021940_embryo 0.22
SRP021940_placental_villous 0.22
SRP021940_synovial_membrane 0.03
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
NSRFKQVEERINLLDDILEEITRAEQKEEKRIRQNENSLRELWDNIKCANIHVIGVP--EERQRGRKLFEE-IIAEIFPNLRKETDTQVQEAQRVPNKTS
NSR.....E.I..LD...................NENS.R..WDNIK..NIH.IGVP..EE...G.....E.IIAE.FPN..KETD.QVQEAQRVPNK..
Retrocopy
NSRADDTKE*ISELDXXXXXXXXXXXXXXXXXXXNENSIRDFWDNIKHSNIHLIGVPEGEEEDKGAEKLFE/IIAENFPNQEKETDIQVQEAQRVPNKRN


Parental protein
PKRPTSRHIIIKMSKIKDKERILKAARERQQVTYKGKPIRLSVDFSAKTLQVRREWHDIFK-VKEKNLQPRILYPAR-LSFTMEGEIKSFQDKQKLKEFI
PKRPT.RHIIIKM..IK.KERILKAARE.QQ.TYKG..IRLS.DFSAKT.Q.RRE...I....K.KNLQPRI..P...LSF.ME...K.....QKLK.FI
Retrocopy
PKRPTPRHIIIKM*RIKVKERILKAAREKQQITYKGNSIRLSADFSAKTSQARREARYIQS\LKGKNLQPRI--PSK\LSFRMERD-KELSK*QKLKGFI


Parental protein
TKKPILQEMLKG
T.K..L..MLKG
Retrocopy
TTKLVL*AMLKG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide