RetrogeneDB ID:
retro_ecab_53
Organism:
Horse ( Equus_caballus )
Location:
10:34783906-34784272 (+)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
88.33 %
Coverage:
98.36 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_ecab_53
GGCGCCCCTGTGGATCTGGAGTTGAAGAAGGTTTTCACAGAGCTTCAAGCCAAAGCTATC
GACACTCAACAGAAAGTGAAGCTTGCAGACATAGAGATTGAACAGCTAAACAGAACGAAA
AAGCATGCACATCTTACAGATACAGAGATTATGACTTTGGTAGATGAGACTAACATATAT
CAAGGTGTAGGAATAATGTTTATTCTTCAATCCAAGGAGGTAATTCACAATCAGCTGTCA
GAGAAACAGAAAATAGCAGAAGAAAAAAGTAAAGAATCGGAACAGAAAAAGTCCTACCAG
CAGTGGAGCATGAAGGAAGCTGAGGACAACATCCGGGAGATGCTGCCGGCACGAAGGGCC
CAGTAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.02
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.03
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
APVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFILQSKEVIHNQLLEKQKIAEEKIKELEQKKSYLE
APVDLELKK.FTELQAK.IDTQQKVKLADI.IEQLNRTKKHAHLTDTEIMTLVDETN.Y.GVG.MFILQSKEVIHNQL.EKQKIAEEK.KE.EQKKSY..
Retrocopy
APVDLELKKVFTELQAKAIDTQQKVKLADIEIEQLNRTKKHAHLTDTEIMTLVDETNIYQGVGIMFILQSKEVIHNQLSEKQKIAEEKSKESEQKKSYQQ


Parental protein
RSVKEAEDNIREMLMARRAQ
.S.KEAEDNIREML.ARRAQ
Retrocopy
WSMKEAEDNIREMLPARRAQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide