RetrogeneDB ID:
retro_ecab_530
Organism:
Horse ( Equus_caballus )
Location:
2:117607569-117608133 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
95.21 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
1


Parental gene:
Parental gene symbol:
RPL18
Parental gene aliases:
No gene alias available
Parental gene description:
60S ribosomal protein L18 [Source:RefSeq peptide;Acc:NP_001182442]

Genomic region (view in browser)





>retro_ecab_530
ATGGGAGTCGACATCCGCCACAACAAGGACCGAAAGGTTCGGCGCAAGGAGCCCAAGAGC
CAGGACATCTACCTGAGACTGTTGGTCAAGCTGTACAGGTTTCTGGCCAGACGAACCAAC
TCCACCTTCAACCAAGTCGTGCTGAAGAGGCTGTTCATGAGTCGCACCAACCAGCCACCT
CTGTCCCTTTCCCACATGATCCGGAAGATGAAGCTTCTTGGCCGGGAAAACAAAACAGCT
GTGGTTGTAGGGACTATCACCGACGACGTGCAGGTCCAGGAGGTGCCCAAACTGAAGGTG
TGTGCCCTGCGTGTGAGCAGTCGTGCCCGGAGCCGCATCCTCAAGGCTGGGGGCAAGATC
CTCACCTTCGACCAGTTGGCCCTGGACTGCCCGAAGTGCTGTGGCACCGTCCTGCTCTCT
GGTCCTCGAAAGGGCCGAGAGGTGTACAGGCATTTCGGCAAGGCTCCAGGGACCCCGCAC
AGCCACACCAAACCCTATGTGCATTCCAAGGGCCGCAAGTTCGAGCACGCCTGAGGCCGA
CGGGCCAGCCGGGGCTACAAAAAC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.93
SRP021940_cerebellum 0.7
SRP021940_embryo 1.77
SRP021940_placental_villous 1.25
SRP021940_synovial_membrane 0.83
SRP021940_testis 1.13

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRPPLSLSRMIRKMKLPGRENKTAVVVGTITDDVRVQEVPKLKV
MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTN.PPLSLS.MIRKMKL.GRENKTAVVVGTITDDV.VQEVPKLKV
Retrocopy
MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNQPPLSLSHMIRKMKLLGRENKTAVVVGTITDDVQVQEVPKLKV


Parental protein
CALRVSSRARSRILKAGGKILTFDQLALDSPKGCGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRSKGRKFERARGRRASRGYKN
CALRVSSRARSRILKAGGKILTFDQLALD.PK.CGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYV.SKGRKFE.A.GRRASRGYKN
Retrocopy
CALRVSSRARSRILKAGGKILTFDQLALDCPKCCGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVHSKGRKFEHA*GRRASRGYKN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide