RetrogeneDB ID:
retro_ecab_533
Organism:
Horse ( Equus_caballus )
Location:
20:3676304-3676831 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
64.41 %
Coverage:
61.32 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
PDCD2
Parental gene aliases:
No gene alias available
Parental gene description:
programmed cell death 2 [Source:HGNC Symbol;Acc:8762]

Genomic region (view in browser)





>retro_ecab_533
GAGCAGGGCTGGACACAATCAGGTAGTGTGGACCGTGCAGCTCCGGACCGCAACTTCCTC
TCCCCAGAATTTGAAATCCTAATAGAAACAGAAGGTGAGATTATGCCTGAAGTTTTGGAA
AAGGAAGATGACTCAGAGACTCCCGGGCGCACAGGAGAAGCGCCTGAAGAAGAATTGGGT
TCCAGAGCAAAACATGAGTCCAGGGAAGAGAAAACTTTCCGGAAGTTTAAAACTAAAATA
GTCCTTGAACCAGAACAGAGTCTCAGACATGGCAGAGGGATTGCTGCCATCTGGATTTCT
GGAGAAAATATTCCTGAAGAACAGGAGATTCCAGACTGCCCCTGTGGTGCCCAGAGGACA
TTTGAATTCCAGATCATGTCTCAGCTGCTCAGCTGCACACAGGCTGGCAGACTGGGCGGG
AGCATCGTCCTGGGCAGCCAGGCTGGCTTCGCCTGTGCAGAAAACTACAGACTGGGCACC
GGCTACACAGAGGACTCTGTGTGGAAGCAAGAGGTAACGATACACCT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KQACTQADNLDNTVPDHNFLFPEFEIVIETEDEITPEVVEKEEESEIIGSMGEAPEEELDSMAKHESREDKVFQKFKTKVALEPEQILRYGRGTAPIWIS
.Q..TQ....D...PD.NFL.PEFEI.IETE.EI.PEV.EKE..SE..G..GEAPEEEL.S.AKHESRE.K.F.KFKTK..LEPEQ.LR.GRG.A.IWIS
Retrocopy
EQGWTQSGSVDRAAPDRNFLSPEFEILIETEGEIMPEVLEKEDDSETPGRTGEAPEEELGSRAKHESREEKTFRKFKTKIVLEPEQSLRHGRGIAAIWIS


Parental protein
AENIPQEEDVPDCPCGAKRIFEFQVMPQLLNYLKADRLGRSVDWGVLAVFTCAESCRLGTGYAEEFVWKQDIT-DTP
.ENIP.E...PDCPCGA.R.FEFQ.M.QLL....A.RLG.S...G..A.F.CAE..RLGTGY.E..VWKQ..T.DTP
Retrocopy
GENIPEEQEIPDCPCGAQRTFEFQIMSQLLSCTQAGRLGGSIVLGSQAGFACAENYRLGTGYTEDSVWKQEVT/DTP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide