RetrogeneDB ID:
retro_ecab_534
Organism:
Horse ( Equus_caballus )
Location:
20:7520153-7520675 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
83.91 %
Coverage:
99.43 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
YRDC
Parental gene aliases:
No gene alias available
Parental gene description:
yrdC domain containing (E. coli) [Source:HGNC Symbol;Acc:28905]

Genomic region (view in browser)





>retro_ecab_534
GTGTACTGCCTCAAGGGCCGCAGCGAGGCCAAGCTGCTAGCCGTATGCCTGGGCCTTGTG
GCCGACATCTACAGGTACTGCCATGTGAGAGCACCCGAGGGGCTCCTGAAAGACCTGTTA
CCAGTACCAATGACCCTGGTGATGGAACGCTCAGAGCAGCTCAACAAGGACCTGAACCCC
TTCACTCCTCTTGTAGGCATCCGGATTCCTGACCATGCCTTCATGCAGGACTTGGCCCGG
GTGTTTGGGGGACCACTTCCCCTCACCAGCGCTCACCTCAGCTCCCAGGCCAGTTCTCTG
AATGTCGAGGAGTTCCAGGACCTCTGGCCTCAGTTGTCCCTGGTCATTGATGGGGAACCA
GCTGGGGATGGCCAGAGCTCTGAGTATCACCTAGGCTCAGCTGTGGTTGACGTGTCTGTG
CCTGGAAGGTTTGGCATCATTTGTCCAGGCTGTGCCCTGGAAAGTACTACAGCCATCCTC
CAACAGAAGTACAGGCTGCTCCCTTCGTACAGATCCTGCTTG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.23
SRP021940_cerebellum 0.2
SRP021940_embryo 0.22
SRP021940_placental_villous 0.09
SRP021940_synovial_membrane 0.05
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VYRLKSRSEPAC-AVCLGRVADVYRYCHVRVPEGLLKDLLPGPVTLVMERSEELNKDLNPFTPLVGIRIPDHAFMQDLAQVFGGPLALTSANLSSQASSL
VY.LK.RSE....AVCLG.VAD.YRYCHVR.PEGLLKDLLP.P.TLVMERSE.LNKDLNPFTPLVGIRIPDHAFMQDLA.VFGGPL.LTSA.LSSQASSL
Retrocopy
VYCLKGRSEAKLLAVCLGLVADIYRYCHVRAPEGLLKDLLPVPMTLVMERSEQLNKDLNPFTPLVGIRIPDHAFMQDLARVFGGPLPLTSAHLSSQASSL


Parental protein
NVEEFQDLWPQLSLVVDGGPIGDGQSPECRLGSTVVDLSVPGKFGIIRPGCALESTTAILQQKYGLLPSHGSCL
NVEEFQDLWPQLSLV.DG.P.GDGQS.E..LGS.VVD.SVPG.FGII.PGCALESTTAILQQKY.LLPS..SCL
Retrocopy
NVEEFQDLWPQLSLVIDGEPAGDGQSSEYHLGSAVVDVSVPGRFGIICPGCALESTTAILQQKYRLLPSYRSCL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide