RetrogeneDB ID:
retro_ecab_536
Organism:
Horse ( Equus_caballus )
Location:
20:22240515-22240860 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
65.81 %
Coverage:
98.32 %
Frameshifts:
0
Stop codons:
1


Parental gene:
Parental gene symbol:
RPS20
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S20 [Source:HGNC Symbol;Acc:10405]

Genomic region (view in browser)





>retro_ecab_536
TTTAGAGATACCAGAGAGACACCCGTGGAACCAGAAGGGGAGAGTCACCAAATTAGAATC
ACTCTCACCAGCTGCAAGGTCAAATCTTTGGGGAAGGTGCATGCTGACTGGATCAGAGGC
GTAAGGAAAAGTCTCAGAGGGAAAAGATCAGTTCAGATGCCTACCACAACTCAGAATCAT
GACAAGAAAACCCCCTGTGATGAAGGCTCTAAGACGTGGGATGGCTTTTAGATGAGGATC
CATAAGCGACTCATTGACTTCCACGGTCCTTCCGGGATTGTTAAGCAGATTACTTCCACC
AGTATTGAGCCAGGAGTCAAGGCTGAAGCCACCACTGTAGATGCT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.1
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
FKDTGKTPVEPEVAIHRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRITTRKTPCGEGSKTWDRFQMRIHKRLIDLHSPSEIVKQIT
F.DT..TPVEPE...H.IRITLTS..VKSL.KV.AD.IRG...K.L..K..V.MPT.T......KTPC.EGSKTWD.F.MRIHKRLID.H.PS.IVKQIT
Retrocopy
FRDTRETPVEPEGESHQIRITLTSCKVKSLGKVHADWIRGVR-KSLRGKRSVQMPTTTQN-HDKKTPCDEGSKTWDGF*MRIHKRLIDFHGPSGIVKQIT


Parental protein
SISIEPGVEVEVTIADA
S.SIEPGV..E.T..DA
Retrocopy
STSIEPGVKAEATTVDA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide