RetrogeneDB ID:
retro_ecab_541
Organism:
Horse ( Equus_caballus )
Location:
20:29788797-29789136 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
60.34 %
Coverage:
63.69 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
NDUFB9
Parental gene aliases:
No gene alias available
Parental gene description:
NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 9, 22kDa [Source:HGNC Symbol;Acc:7704]

Genomic region (view in browser)





>retro_ecab_541
TACCTGACCCACCAGCAGAAGGTGTTACAGCTTTCTAAGAGTGTGCCGTGCCACTTCAAG
TCTTGGTGCATCCACAGGGACAAATACTCATCCTTTGCTTATGTGATGAGAACCTGGTTT
GAAGAACATAAGAATGAAAGGGATTTGGTAAAGGCTACCCAACCGCTGAAGGAGCCAGAG
GAAGAGTTCTGGCGATCAGCATCCATGGCCGTGTGTCTTCCGTGACTCTCCTGAGGGCAC
CTCTTCAGAGGGAGATGAGTGTTCCAAGGCTCTGCACGGTGCTTAGCTGACTGGCATCCT
TCTGAGAGGACCATGTATCCTGATTTCTTTGCTGAGAGA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
YLTHQQKVLRLYKRALRHLESWCIHRDKYRYFACLLRARFEEHKNEKDMVKATQLLREAEEEFWY-NQHPQPYIFPESPGGTSYERYECYKVPEW-CLDD
YLTHQQKVL.L.K....H..SWCIHRDKY..FA...R..FEEHKNE.D.VKATQ.L.E..EE.....QHP.P..F..SP.GTS.E..EC.K.....CL.D
Retrocopy
YLTHQQKVLQLSKSVPCHFKSWCIHRDKYSSFAYVMRTWFEEHKNERDLVKATQPLKEP-EEEFW\DQHPWPCVFRDSPEGTSSEGDECSKALHG/CLAD


Parental protein
WHPSEKAMYPDYFAKR
WHPSE..MYPD.FA.R
Retrocopy
WHPSERTMYPDFFAER


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide