RetrogeneDB ID:
retro_ecab_547
Organism:
Horse ( Equus_caballus )
Location:
20:19100391-19101594 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
94.01 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
RBM17
Parental gene aliases:
No gene alias available
Parental gene description:
RNA binding motif protein 17 [Source:HGNC Symbol;Acc:16944]

Genomic region (view in browser)





>retro_ecab_547
ATGTCCCTGTATGACGACCTGGGAGTGGAGACCAGTGACTCGAAAACAGAAGGCTGGTCC
AAAAACTTCACACTTCTGCAGTCTCAGCTTCAGGTGAAGAGGGCAGCTCTCACTCAGGCA
AAGAGCCAGAGGACAAAACAAAGTACAGTCCTCGCCCCAGTCATCGACCTAAAGCGAGGT
GGCTCTTCAGACGACCGGCAGATCGTGGACACCCCGCCGCACGTAGCCGCCGGCCTGAAG
GATCCTGTTCCCAGTGGATTTTCTGCAGGAGAAGTTCTGATTCCTTTAGCTGATGAATAT
GATCCTAGGTTTCCTAATGATTATGAGAAAGTAGTGAAGCGCCAAAGAGAAGAACGACAG
AGACAGCGGGAGCTGGAAAGACAAAAAGAAATAGAAGAGAGAGAAAAGAGGCGTAAAGAC
AGACATGAAGCTAGTGGGTTTTCAAGGCGAACAGATCCAGATTCTGATGAAGATGAAGAT
TATGAGCGAGAGAGGAGGAAAAGAAGTATGGGCGGAGCTGCCATCACACCACCCACTTCT
CTTGTAGAGAAAGACAAAGAGTTACCCCGAGATTTTCCACATGAAGAGGATTCAAGACCT
CGCTCACAGTCTTCCAAAGCTGGTATCCCTCCCCCGGTGTACGAGGAGCAAGACAAACCC
CGATCTCCGACCGGACCTGGCAACTCCTTCCTTGCCAACATGGGTGGCACAGTAGCACAT
AAAATCATGCAGAAGTATGGCTTCCGGGAAGGCCAGGGTCTTGGGAAGCACGAGCAAGGG
CTGAGCATGGCGTTGTCAGTGGAGAAGACAAGCAAGCGAGGCGGCAAGATCATTGTGGGC
GACGCCACGGAGAAAGATGCAGCCAAGAAGTCGGATTCAAATCCACTGACTGAAATACTG
AAGTGTCCTACTAAAGTGGTCCTACTAAGGAACATGGTTGGTGCAGGAGAGGTAGATGAA
GACTTGGAAGTTGAAACCAAGGAAGAATGTGAAAAATATGGCAAAGTTGGAAAATGTGTG
ATATTTGAAATTCTTGGTGCCCCTGATGATGAAGCAGTACGAATATTTTTAGAATTTGAA
AGAGTTGAATCAGCAATTAAAGCTGTTGTTGATCTGAACGGGAGGTATTTTGGTGGACGG
GTGGTAAAAGCATGTTTCTACAATTTGGATAAATTCAGGGTCTTGGATTTGGCGGAACAA
GTT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 1.39
SRP021940_cerebellum 0.5
SRP021940_embryo 0.93
SRP021940_placental_villous 0.58
SRP021940_synovial_membrane 0.99
SRP021940_testis 1.31

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSLYDDLGVETSDSKTEGWSKNFKLLQSQLQVKKAALTQAKSQRTKQSTVLAPVIDLKRAGSSDDRQIVDTPPHAAAGLKDPVPSGFSAGEVLIPLADEY
MSLYDDLGVETSDSKTEGWSKNF.LLQSQLQVK.AALTQAKSQRTKQSTVLAPVIDLKR.GSSDDRQIVDTPPH.AAGLKDPVPSGFSAGEVLIPLADEY
Retrocopy
MSLYDDLGVETSDSKTEGWSKNFTLLQSQLQVKRAALTQAKSQRTKQSTVLAPVIDLKRGGSSDDRQIVDTPPHVAAGLKDPVPSGFSAGEVLIPLADEY


Parental protein
DPMFPNDYEKVVKRQREERQRQRELERQKEIEEREKRRKDRHEASGFSRRPDPDSDEDEDYERERRKRSMGGAAIAPPTSLVEKDKELPRDFPYEEDSRP
DP.FPNDYEKVVKRQREERQRQRELERQKEIEEREKRRKDRHEASGFSRR.DPDSDEDEDYERERRKRSMGGAAI.PPTSLVEKDKELPRDFP.EEDSRP
Retrocopy
DPRFPNDYEKVVKRQREERQRQRELERQKEIEEREKRRKDRHEASGFSRRTDPDSDEDEDYERERRKRSMGGAAITPPTSLVEKDKELPRDFPHEEDSRP


Parental protein
RSQSSKAAIPPPVYEEQDRPRSPTGPGNSFLANMGGTVAHKIMQKYGFREGQGLGKHEQGLSTALSVEKTSKRGGKIIVGDATEKDAAKKSDSNPLTEIL
RSQSSKA.IPPPVYEEQD.PRSPTGPGNSFLANMGGTVAHKIMQKYGFREGQGLGKHEQGLS.ALSVEKTSKRGGKIIVGDATEKDAAKKSDSNPLTE..
Retrocopy
RSQSSKAGIPPPVYEEQDKPRSPTGPGNSFLANMGGTVAHKIMQKYGFREGQGLGKHEQGLSMALSVEKTSKRGGKIIVGDATEKDAAKKSDSNPLTEXX


Parental protein
KCPTKVVLLRNMVGAGEVDEDLEVETKEECEKYGKVGKCVIFEIPGAPDDEAVRIFLEFERVESAIKAVVDLNGRYFGGRVVKACFYNLDKFRVLDLAEQ
..........NMVGAGEVDEDLEVETKEECEKYGKVGKCVIFEI.GAPDDEAVRIFLEFERVESAIKAVVDLNGRYFGGRVVKACFYNLDKFRVLDLAEQ
Retrocopy
XXXXXXXXXXNMVGAGEVDEDLEVETKEECEKYGKVGKCVIFEILGAPDDEAVRIFLEFERVESAIKAVVDLNGRYFGGRVVKACFYNLDKFRVLDLAEQ


Parental protein
V
V
Retrocopy
V


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide