RetrogeneDB ID:
retro_ecab_549
Organism:
Horse ( Equus_caballus )
Location:
20:22675412-22675705 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
67.65 %
Coverage:
50.25 %
Frameshifts:
3
Stop codons:
2


Parental gene:
Parental gene symbol:
AP3S2
Parental gene aliases:
No gene alias available
Parental gene description:
adaptor-related protein complex 3, sigma 2 subunit [Source:HGNC Symbol;Acc:571]

Genomic region (view in browser)





>retro_ecab_549
ATAATCAAGGCAATCCTCACTTTCAACAACCATGGGAAGCATCAGCTCTTCAAGTTCTAC
TAACCTTACAGTGAAGACACAACAGCAGATTATCAGGGAGACTTTCCATTTGGCATTTAA
GAGAGATGAAATGTTTGTAATTCCCCAGAAGGAGGATTACTAATTGGAGGATCTGACAAC
AAACTGACTTATAGACATTACACACCGTTATATTTTGTCTTCTGTGTGCATTCTTCAGAG
AGTGAACTTGGCATTTTAAATCTAATTTGAGTATTCCTGGAACATTAGACAAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.1
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MIQAILVFNNHGKPRLVRFYQRFPEEI-QQQIVRETFHLVLKRDD-NICNFLEGGSLIGGSDYKLIYRHYATLYFVFCVDSSESELGILDLIQVFVE-TL
.I.AIL.FNNHGK..L..FY....E...QQ.I.RETFHL..KRD..N.CN..EGG.LIGGSD.KL.YRHY..LYFVFCV.SSESELGIL.LI.VF.E.TL
Retrocopy
IIKAILTFNNHGKHQLFKFY*PYSEDT\QQ-IIRETFHLAFKRDE/NVCNSPEGGLLIGGSDNKLTYRHYTPLYFVFCVHSSESELGILNLI*VFLE/TL


Parental protein
DK
DK
Retrocopy
DK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide