RetrogeneDB ID:
retro_ecab_558
Organism:
Horse ( Equus_caballus )
Location:
20:54043161-54043887 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
79.28 %
Coverage:
70.09 %
Frameshifts:
5
Stop codons:
3


Parental gene:
Parental gene symbol:
RRAGD
Parental gene aliases:
No gene alias available
Parental gene description:
Ras-related GTP binding D [Source:HGNC Symbol;Acc:19903]

Genomic region (view in browser)





>retro_ecab_558
GACATGATCTTCAGGGGAACATGAGCACTGATATTTGTTATTGACTCTCGGGAGGATAAC
ATGGAAGCCCTGGCCAGGCTCCACCTCGTAGTCACCAGGGCCTACAAAGTAAACACCAGC
ATCAAATTTGAGGTGTTATTCACAAAGTAGATGGTCTGTCAGATGACCACAAAATTGAAA
TCCATAGAGATACTCACCAGAGAGCAAATAATGACGTTGCAGATGCTGAATTAGAAAAAA
GCTCACCTCAGCTTTTATCTGACAACCATGTATGATTATTCAATATTTTAAGTTTTTAGC
AAAGTGATTCAGAATTGATTCCATATCTCTCAACCCTGGAGAATTTGCTGAACATCTTTA
TGTCAAATTCTGGAGTTGATAAGGCATTTCTGTTTCACGTGGTCAGGAAAATTTATAATG
CAACCGATAGTACCCAGCAAACCTATGAGCTCTGCTGTGATATGATAGATGTGTTATCGA
CATCTCTTGAATTTATGGTCTCAAAGAAGATGGAGCAGGAACTGCTAATGACAACAAATC
AACAGCCATTATAAAGCTGAATATTACAACGGTTCTTTATTTAAAAGAAGTGACAATATT
TCTGGCTCTTGTTGCTTTGTTGGAGATGAAAGCTTTGAAAGAAAAGGTCTTATTGATTAT
AATTTTCATTGCTTCTGGAAGGCCATCCATGATGTTTTTGAGGTAAGAATGAAAATGGTG
AAATCT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
EMIFRGTGALIFVIDSQDDYMEALARLHLTVTRAYKVNTDINFEVF-IHKVDGLSDDHKIETQRDIHQRANDDLADAGLEK-IHLSFYLTSIYDHSIFEA
.MIFRGT.ALIFVIDS..D.MEALARLHL.VTRAYKVNT.I.FEV..IHKVDGLSDDHKIE..RD.HQRAN.D.ADA.LEK..HLSFYLT..YD.SIF..
Retrocopy
DMIFRGT*ALIFVIDSREDNMEALARLHLVVTRAYKVNTSIKFEVL/IHKVDGLSDDHKIEIHRDTHQRANNDVADAELEK\AHLSFYLTTMYDYSIF*V


Parental protein
FSKVVQ-KLIPQLPTLENLLNIFISNSGIEKAFLFDVVSKIYIATDSTPVDMQTYELCCDMIDV-VIDISCIYGLKEDGAGTPYDKESTAIIKLNNTTVL
FSKV.Q..LIP.L.TLENLLNIF.SNSG..KAFLF.VV.KIY.ATDST....QTYELCCDMIDV.VIDIS.IYGLKEDGAGT..D..STAIIKLN.TTVL
Retrocopy
FSKVIQ/ELIPYLSTLENLLNIFMSNSGVDKAFLFHVVRKIYNATDST---QQTYELCCDMIDV/VIDIS*IYGLKEDGAGTANDNKSTAIIKLNITTVL


Parental protein
YLKEVTKFLALV-CFVREESFERKGLIDYNFHCFRKAIHEVFEVRMKVVKS
YLKEVT.FLALV.CFV..ESFERKGLIDYNFHCF.KAIH.VFEVRMK.VKS
Retrocopy
YLKEVTIFLALV/CFVGDESFERKGLIDYNFHCFWKAIHDVFEVRMKMVKS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide