RetrogeneDB ID:
retro_ecab_561
Organism:
Horse ( Equus_caballus )
Location:
21:5856285-5856653 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
56.49 %
Coverage:
82.55 %
Frameshifts:
6
Stop codons:
2


Parental gene:
Parental gene symbol:
DNAJC15
Parental gene aliases:
No gene alias available
Parental gene description:
DnaJ (Hsp40) homolog, subfamily C, member 15 [Source:HGNC Symbol;Acc:20325]

Genomic region (view in browser)





>retro_ecab_561
ACCACCAGACCCTATGCCAACATTGCCAGGGCCTGGCAAGACAGGGTCAGTAGTGGGATT
GGCTGTTGCAGGCTTTGCAGTTTTGTGTATTTTACAGCTGCATATTTCAAGTCTGGAAAA
TTCTGCAACAAGTAATCACAGAAAATGTGAAAATTTCAACCCCGAGCATTCCATCTTCTT
ATAAAAAGAATTTAAACAAAAAATGAGTAGGCGTGAAGCTAGACTTATTTTAGGTGTAAG
CCCATCTGCTGGTAAAGCTGGAATTAGAACGGGTCACAGGAAATCATGATTGTGAATTAA
GCAGATAACAGGGATTCTCCTATTTAGCAACCCAAAGATGCAAAGTAGAAATCGTGCTGG
ATTGAACA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
TRRPDADID-QGLAR-SLIAVGLGVA-ALAFAGRYA--FQIWKPLEQVITDAAKKISVQSLSSYYKGG-FEQKMSRREASLILGVSPSAGKAKIRTAHRR
T.RP.A.I..QGLAR.....VGL.VA.AL.F...Y...FQ.WK.L.QVIT...K.IS..S..S.YK...F.QKMSRREA.LILGVSPSAGKA.IRT.HR.
Retrocopy
TTRPYANIA/QGLAR/TGSVVGLAVA\ALQFCVFYSCIFQVWKILQQVITENVK-ISTPSIPSSYKKN/FKQKMSRREARLILGVSPSAGKAGIRTGHRK


Parental protein
-IMILNHPDKGGSP-YLATKINEAKDLLEAT
.IMI.N..D...SP.YLAT........L..T
Retrocopy
/IMIVN*ADNRDSP/YLATQRCKVEIVLD*T


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide