RetrogeneDB ID:
retro_ecab_566
Organism:
Horse ( Equus_caballus )
Location:
21:26260160-26261019 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
58.25 %
Coverage:
66.51 %
Frameshifts:
5
Stop codons:
5


Parental gene:
Parental gene symbol:
CCDC11
Parental gene aliases:
No gene alias available
Parental gene description:
coiled-coil domain containing 11 [Source:HGNC Symbol;Acc:26530]

Genomic region (view in browser)





>retro_ecab_566
TTTGTGACTGGAAAGCTAGACAACAATTCAGGGAGTGCTGTGAGGAGCTCCGCGTTGAGC
TGCTTGCATTCATCAGAAAGTGTGTGAGGAACAGAAAGCACAGACAGAACTTAGAGAGGA
ACTGAAGAGGCAGAAACTGGTGAAAGAAGAGACACTCTAGAACTTCCAGAGGAAGACCGA
TGAGCCAAGGAAAAGTGAGAAGCCCAAGAGGCGAGGAGTCAGAAAGAGCCAGTGCAGAAC
ACACACCTGGGATAGGATGCCTACGTCACCAACATCAAAGCACAAAGGCCGGTGGTCCAG
TGGCCGAGGGAAGAGGCAGCTCACCTTGTGGCAGATGACAACACAAGGCTAAACTTGAGA
ACGAAAAGGATAAGCTGAAGAAACAGAAGACAAAGCAAGAAATTAGAACCCTTTTGCAAA
AAGCCCTCCAACAGAAGGTAAAGCATATTCAGCAGGAATACAAAACAGAGCAAGACTTGA
ACTTGAAGCTCGTGCAAAGGGTCCTTCGAGACTTACAGGAAGAGGCTGATAAAAAAGAAG
CAAAAAGGAAGACATGGGAAGAAAACAGAAGATATCTCATGAGCATGTGACACAGCAATG
TAAGGAAGAGAAAGCTCAGGAGAAAGAAGTGGACAAAATAATAGAAGAGGAGAAGGAAAA
GAAGTTTGCTGAGAAAGACAGGCAGCTGAAATTTGAAAAGAAGGCGCGGAAACAGCGCTT
GTGAATGAGGTCACGTGTAAAGAAAAATTAAAGAAATGTTGCAAGAAAAGCAAAAGAACA
GGAAGAATGTGCTATGAAACAGGATCACACAAATGAAGGTCCTAAAGAACTTGACAGCGA
AGAAGAGAACTTCGTAAGA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
FVAEKLD-QQFRERCEELRVEL-SCIHEKKVCEERKAQVAFNEELKRQKLVEEQMF-SKLWEEDRLAKEKREAEEARRQKELVENTRLGLNAQITSIKAQ
FV..KLD.QQFRE.CEELRVEL..CIH.K.VCEE.KAQ....EELKRQKLV.E......L.EEDR.AKEK.EA.EAR.QKE.V.NT.LG..A..T.IKAQ
Retrocopy
FVTGKLD/QQFRECCEELRVEL/ACIHQK-VCEEQKAQTELREELKRQKLVKEETL/LELPEEDR*AKEK*EAQEARSQKEPVQNTHLG*DAYVTNIKAQ


Parental protein
RQAEQRLKEEEARLVEKDKAQV-KLENEQDKLKTQKTKREIKTALQKALQEKIEKIQQGYREEQDLDMKLVQMALQDLQEEADKKKQKR-EEMVREQKIY
R...Q...EE.A.LV..D.....KLENE.DKLK.QKTK.EI.T.LQKALQ.K...IQQ.Y..EQDL..KLVQ..L.DLQEEADKK..KR.E.M.R.QKI.
Retrocopy
RPVVQWPREEAAHLVADDNTRL/KLENEKDKLKKQKTKQEIRTLLQKALQQKVKHIQQEYKTEQDLNLKLVQRVLRDLQEEADKKEAKR/EDMGRKQKIS


Parental protein
RQYLAQRREEDKAQEKELDRILEEEEKKKLAEKDKELRLEKEARKQLVNEVMCTRKLQVQEKLQRKAKEQEERAMEQERINEGLKELNREEKENFAR
.....Q...E.KAQEKE.D.I.EEE..KK.AE..K...L..E.........M..R.........RKAKEQEE.AM.Q...NEG.KEL..EE.ENF.R
Retrocopy
HEHVTQQCKEEKAQEKEVDKIIEEEKEKKFAE--KDRQLKFEKKARKQRL*MRSRVKKN*RNVARKAKEQEECAMKQDHTNEGPKELDSEE-ENFVR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide