RetrogeneDB ID:
retro_ecab_567
Organism:
Horse ( Equus_caballus )
Location:
21:35115237-35115667 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
72.79 %
Coverage:
94.19 %
Frameshifts:
1
Stop codons:
4


Parental gene:
Parental gene symbol:
FUNDC1
Parental gene aliases:
No gene alias available
Parental gene description:
FUN14 domain containing 1 [Source:HGNC Symbol;Acc:28746]

Genomic region (view in browser)





>retro_ecab_567
AAATATGAAAGTGATGATGATTCTTATGAAGTGTTGGATTTAACTGAATCTATAAGAAGA
TATGTTTGGTAGAGTTGAGTGTTTGGCCACAGTTCAGGATTTATGGTAGAAAAATACTCA
GTAGCCACCCAGATTGTAATGGGTGGAATGACTGGTCCGTGTGCAGGATTTTTGTTCCAG
AAAGTTGGAAAACTTGGAGCAACTGCAGTAGGTAATGGCTTTCTTCTTGTTCAGACTTTC
AGTCACAGTGGCTATGGACAGATCAACTGGGAGAGTTGAAAAAGAAACAAAGCAAGAAGA
CATGATCAAGAAATGAGCAAATAAAGCAGCACCTGAAATCAACATAATTGAAGAAGCAGC
AGTATTTATCAAACAGGATATGATGATGTCCGGTGGATTTGTGGGAGGCTATTTGGTAGG
GCTTGCATCC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
EYESDDDSYEVLDLTEYARRHHWWNRVFGHSSGPMVEKYSVATQIVMGGVTGWCAGFLFQKVGKLAATAVGGGFLLLQIASHSGYVQIDWKRVEKDVNKA
.YESDDDSYEVLDLTE..RR..W...VFGHSSG.MVEKYSVATQIVMGG.TG.CAGFLFQKVGKL.ATAVG.GFLL.Q..SHSGY.QI.W.......NKA
Retrocopy
KYESDDDSYEVLDLTESIRRYVW*S*VFGHSSGFMVEKYSVATQIVMGGMTGPCAGFLFQKVGKLGATAVGNGFLLVQTFSHSGYGQINWES*KR--NKA


Parental protein
KR-QIKKRANKAAPEINNIIEEATEFVKQNIVISSGFVGGFLLGLAS
.R..IKK.ANKAAPEI.NIIEEA..F.KQ....S.GFVGG.L.GLAS
Retrocopy
RR\MIKK*ANKAAPEI-NIIEEAAVFIKQDMMMSGGFVGGYLVGLAS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide