RetrogeneDB ID:
retro_ecab_572
Organism:
Horse ( Equus_caballus )
Location:
21:8846585-8847196 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
78.64 %
Coverage:
86.5 %
Frameshifts:
1
Stop codons:
6


Parental gene:
Parental gene symbol:
REXO2
Parental gene aliases:
No gene alias available
Parental gene description:
RNA exonuclease 2 [Source:HGNC Symbol;Acc:17851]

Genomic region (view in browser)





>retro_ecab_572
ATGGTGACGGGAGAGAGCATGGCTCAGCAGATGGTCTGAGTGGACCCAGTGATGATAGGA
TTGGACATTGTGGAGGACCAGATAATTGAGATGGCCTGTCTGATAACTGACTCTGATCTC
AACATTTTAGCTGAAGGTCCTACACTGATTATAAAACAGCCAGACAAATTACTGGACATC
ATGTCAGATTAGCGCAAGAAGCATCATGTAAGTCTGGTCTAACCAAAGCAGTGAGGGAGA
GTACAATGACATTGTAGCAGGCAGACTATGAATTTCTCTCCTTTGTACAATAGCAGGCAC
TTCTGGTGCTCTGTCCACTTGCAGGAAATTCAATTCATGCAGATAAGAAGTTTCTTGAAA
AATACATGCTCCAGTTTGTAAAACATCTTCGTTAGAGAATAAGTGATGTGAGCACTGTTA
AAGAACCGTGCAGATGCTGGTATCCAGAAGAATATGAATTTGCACCAAAGAAGGCCGCTT
CTCACAGGGCTCTTGATGACATTAGTGAAAGCACCAAAGAACTTTGGTTTTACTGAAATA
ACATCTTCACGAAAATAACAGATGAAAAGAGGAAAATTACAGAAAATTGGGAAAATAAGA
AGACTGTGAGT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAAGESMAQRMVWVDLEMTGLDIEKDQIIEMACLITDSDLNILAEGPNLIIKQPDELLDSMSDWCKEHHG-KSGLTKAVKESTMTLQQAEYEFLSFVRQQ
M..GESMAQ.MV.VD..M.GLDI..DQIIEMACLITDSDLNILAEGP.LIIKQPD.LLD.MSD..K.HH..KSGLTKAV.ESTMTL.QA.YEFLSFV..Q
Retrocopy
MVTGESMAQQMV*VDPVMIGLDIVEDQIIEMACLITDSDLNILAEGPTLIIKQPDKLLDIMSD*RKKHHV/KSGLTKAVRESTMTL*QADYEFLSFVQ*Q


Parental protein
TPPGLCPLAGNSVHADKKFLDKYMPQFMKHLHYRIIDVSTVKELCRRWYPEEYEFAPKKAASHRALDDISESIKELQFYRNNIFKKKTDEKKRKIIENGE
....LCPLAGNS.HADKKFL.KYM.QF.KHL..RI.DVSTVKE.CR.WYPEEYEFAPKKAASHRALDDISES.KEL.FY.NNIF.K.TDE.KRKI.EN.E
Retrocopy
ALLVLCPLAGNSIHADKKFLEKYMLQFVKHLR*RISDVSTVKEPCRCWYPEEYEFAPKKAASHRALDDISESTKELWFY*NNIFTKITDE-KRKITENWE


Parental protein
NEKTVS
N.KTVS
Retrocopy
NKKTVS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide