RetrogeneDB ID:
retro_ecab_573
Organism:
Horse ( Equus_caballus )
Location:
21:16747892-16748201 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
68.93 %
Coverage:
84.03 %
Frameshifts:
0
Stop codons:
1


Parental gene:
Parental gene symbol:
RPS20
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S20 [Source:HGNC Symbol;Acc:10405]

Genomic region (view in browser)





>retro_ecab_573
GATACTGGAAGGACACATGCAAAATCAGAGGTGGTGGCTCACTGAATGAGAATTACTCCA
ACCAGTCGCAATGTAAAATCTCTGCAGAAGGTGCATGCTGACTTGATCAGAGGCACAAAG
GACAGGAATCTCAAAATGAAAGGACAAATTCAAATGTCTACCAAGACTCTGAGAGTTGCT
ATAAGAAAAACTCCTTGTGGAGAAGATTCTAAGACTCTAGATTTTCCAAAATCGTTCCAG
ATGAGGATCCACAAGCGACTCACTGAGTTGCACAGTCCTCCAGAGATTGTCAAGCAGATT
ACTTCCATC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.06
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.13
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.24

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
DTGKTPVEPEVAIHRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRITTRKTPCGEGSKTWD---RFQMRIHKRLIDLHSPSEIVKQI
DTG.T....EV..H..RIT.TSRNVKSL.KV.ADLIRG.K..NLK.KG...M.TKTLR...RKTPCGE.SKT.D....FQMRIHKRL..LHSP.EIVKQI
Retrocopy
DTGRTHAKSEVVAH*MRITPTSRNVKSLQKVHADLIRGTKDRNLKMKGQIQMSTKTLRVAIRKTPCGEDSKTLDFPKSFQMRIHKRLTELHSPPEIVKQI


Parental protein
TSI
TSI
Retrocopy
TSI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide