RetrogeneDB ID:
retro_ecab_575
Organism:
Horse ( Equus_caballus )
Location:
21:26211664-26213090 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
65.22 %
Coverage:
83.75 %
Frameshifts:
5
Stop codons:
4


Parental gene:
Parental gene symbol:
ACCSL
Parental gene aliases:
No gene alias available
Parental gene description:
1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional)-like [Source:HGNC Symbol;Acc:34391]

Genomic region (view in browser)





>retro_ecab_575
GACCTGGTGCTGGAAGAGGAGAGTCAGAACCAGGCCACTCAAGAGCAGGAAGCCCTCTTG
GACCACCTAATGTGCCAGATGGTCAATCTGCTACAGTCTGGGACCACAGGTGGCCTGGGG
ATCCAACTATCTTGTCCTTCCCTAGACTCTAAGGGTGATGTCAGTGGTGGGCAGTGGGCT
CAGTCATGCAGGCAGCCTAGGCAGCTTGTTCACCAACTGAGTGATTTTGAAGCTGCATTT
GTCAGCTGTGACCTGTCCAATCATGGGATTGATATCTCTCCCTTACACCACTCCAGCTTT
CAGGACTACATTACCTACCAAGGAGGCAAATACCACGAGGACAAGAACACCCTGGCTTCA
TTAACCTTGGTTCCAGTGAGAATACGCTCTGCATTGATCTGGTGACTTCCGGTTGAGTCA
GAGTGACATGAACCGCATTGAGGAGATCCCACTGTAAGATCCCGATTAGAGAGGGCAACT
GTTCCTGCAGGAAGAAGCGTCTCAGTTCCTGACCTCTTGCTGCAAGGCTCCTGCTTATCT
CGATCCAGAAAACTCGGTTGTTCTAAATGGCCGCTGCTCTGTCTTCTCTGTGCTGGCCAT
GGTTCTGTGTGATCCAGGTGAGGCCTTCCTGATTCCCATCCCCTTTCATGGTGGCTTTGT
CGTTAGATCCCTCCTGCATGCGAAAGTTGAGCTGATTCTTGTCTACCTGGACAGTGAGAT
CACTGATCCGAACATCTGTGCTTTCCAGCTTGCTGTGGGCAAGTTGAAGCAAGCCCTGCC
GAAGGCTGGGCTTAAGGGGAAAAAGGTAGGGGACCTCAGGCTAATTCACTCTCAGAATCC
TCCGGGTGACATCTACTTCCAAGACTCATTGAAGGAATACCTGGAATTTGCCAAGAGGTA
TAACCTACATGTGATTATAGATGAGAGGTATGTGTTATCTATGTTGGATGAATCTGTCGT
ATTCCACAGAGTTCTGAGCTGAAAGTTTACTGACCCCAACAGGACCCACGTGATCTGGTG
TACCAGTAAGGATTTTGCATCTCTAGCTTCTGCTTTGGCACTCTGTATACCCACAATAAG
GCGATGGTCTCTGCCGTGAGCTCCTTTGGCCACCTCCGCAGAATGTCTGGCATCACCCAG
CTTGAACTGTGTTGCTGTTCCTGGACAGAGAATGGATTGACGAAGTGCATCTGACCACTA
ATCGCTCCCAGCTGCAGGCAGCTCACAGGTACATCATTAACAAGTCGAAGCTTTGGAGAT
CCCCTTTCTCAATCGTGTCTCTGGCCTCAGTGTCTGGATTAACTTGAAAAAGTACCTGGA
CTCATGCACATTTGAGAAGGAGCTGCTTTCCCATTGCTGATTCCTGGACAACAAGCTGGT
GCTGTCTCATGGTAAGACCTATAAATGTAAGGAGCCTGGCTGGTTC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.08
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
DLPLEEQRHNQATGEQEAF----LRRVVNLLQSGAMWGLGLQAPRPTLGPRDDAGGGQQAQLSRQLDQLVHQLSHLEVAFVSHDLSNRGIDISAFERSKF
DL.LEE...NQAT.EQEA.........VNLLQSG...GLG.Q...P.L....D..GGQ.AQ..RQ..QLVHQLS..E.AFVS.DLSN.GIDIS....S.F
Retrocopy
DLVLEEESQNQATQEQEALLDHLMCQMVNLLQSGTTGGLGIQLSCPSLDSKGDVSGGQWAQSCRQPRQLVHQLSDFEAAFVSCDLSNHGIDISPLHHSSF


Parental protein
QDFKTYQGDKYHEDKNTM-GFINLGVSENKLCTDLMTE-RLSRSDMNHLEDALLQYSDQRGQPFLREEVARFLTYYCKSPARLDPENVVVLSGCCSVFSA
QD..TYQG.KYHEDKNT..GFINLG.SEN.LC.DL.T..RLS.SDMN..E...L...D.RGQ.FL.EE...FLT..CK.PA.LDPEN.VVL.G.CSVFS.
Retrocopy
QDYITYQGGKYHEDKNTL/GFINLGSSENTLCIDLVTS/RLSQSDMNRIEEIPL*DPD*RGQLFLQEEASQFLTSCCKAPAYLDPENSVVLNGRCSVFSV


Parental protein
LATVLCDPGEALLTPTPFFGGLVMGSYLYSKVELMPVHLDSEITDGSARPFQLTVDKLEQALLEATLKGKKVRGLLLINPQNPLGDVYSRDSLEEYLEFA
LA.VLCDPGEA.L.P.PF.GG.V..S.L..KVEL..V.LDSEITD.....FQL.V.KL.QAL..A.LKGKKV..L.LI..QNP.GD.Y..DSL.EYLEFA
Retrocopy
LAMVLCDPGEAFLIPIPFHGGFVVRSLLHAKVELILVYLDSEITDPNICAFQLAVGKLKQALPKAGLKGKKVGDLRLIHSQNPPGDIYFQDSLKEYLEFA


Parental protein
KRYNLHVIIDELYMLSVFDDSVTFHSVLSMESLPDPNRTHMIWGTSKDFG-ISGFRFGALYTHNKEVASAVSSFGFLNGISGITQYKLC-RLLQDREWID
KRYNLHVIIDE.Y.LS..D.SV.FH.VLS.....DPNRTH.IW.TSKDF..IS.F.FG.LYTHNK...SAVSSFG.L...SGITQ..LC..L..DREWID
Retrocopy
KRYNLHVIIDERYVLSMLDESVVFHRVLS*K-FTDPNRTHVIWCTSKDFA/ISSFCFGTLYTHNKAMVSAVSSFGHLRRMSGITQLELC/LLFLDREWID


Parental protein
KVYLPTNHSRLKAAHRYITNKLK-ALKIPFLNRGSGLYVWMNLKEYLQPCTFEEELLLHHRFLGNKLILSPGKTYMCKEPGWF
.V.L.TN.S.L.AAHRYI.NK.K.AL.IPFLNR.SGL.VW.NLK.YL..CTFE.ELL.H..FL.NKL.LS.GKTY.CKEPGWF
Retrocopy
EVHLTTNRSQLQAAHRYIINKSK/ALEIPFLNRVSGLSVWINLKKYLDSCTFEKELLSHC*FLDNKLVLSHGKTYKCKEPGWF


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide