RetrogeneDB ID:
retro_ecab_58
Organism:
Horse ( Equus_caballus )
Location:
X:115716039-115716393 (+)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
97.44 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
RPL34
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L34 [Source:HGNC Symbol;Acc:10340]

Genomic region (view in browser)





>retro_ecab_58
ATGGTCCAGCGTTTGACCTACCGCCATAGGCTCTCCTACAACACAGCGTCTAACAAAACG
AGGCTGTCCCGAACCCCTGGTAATAGGATTGTTTACCTTTATACCAAGAAAGTTGGGAAA
GCACCGAAGTCCGCGTGTGGCGTGTGCCCAGGCCGACTGCAAGGCGTTCGTGCTGTGAGG
CCTAAAGTTCTTATGAGATTGTCTAAAACGAAAAAACACGTCAGCAGGGCCTACGGAGGT
TCCATGTGTGCTAAATGTGTCCGCGACAGGATCAAGCATGCTTTCCTTATTGAGGAGCAG
AAAATCGTTGTGAAAGTGTTGAAGGCACAAGCACAGAGTCAGAAAGCTAAATAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 18.12
SRP021940_cerebellum 10.85
SRP021940_embryo 20.27
SRP021940_placental_villous 7.74
SRP021940_synovial_membrane 12.66
SRP021940_testis 8.01

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVRPKVLMRLSKTKKHVSRAYGGSMCAKCVRDRIKRAFLIEEQ
MVQRLTYR.RLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRL.GVRAVRPKVLMRLSKTKKHVSRAYGGSMCAKCVRDRIK.AFLIEEQ
Retrocopy
MVQRLTYRHRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLQGVRAVRPKVLMRLSKTKKHVSRAYGGSMCAKCVRDRIKHAFLIEEQ


Parental protein
KIVVKVLKAQAQSQKAK
KIVVKVLKAQAQSQKAK
Retrocopy
KIVVKVLKAQAQSQKAK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide