RetrogeneDB ID:
retro_ecab_587
Organism:
Horse ( Equus_caballus )
Location:
22:19807802-19808094 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
70.41 %
Coverage:
93.27 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
NDUFB2
Parental gene aliases:
No gene alias available
Parental gene description:
NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 2, 8kDa [Source:HGNC Symbol;Acc:7697]

Genomic region (view in browser)





>retro_ecab_587
GCGCCTTTCATTTGTGTTGGAGGCCACCTCTTCAGAGGGATCCGCTCGGGCAGCTGGAGG
CAGTGGAGTCCGTCACACCAGTGGTGGTGTGCATATCCAGCCCCGATACAGGCACTTCCC
CCAGCTGACCAGATCCTAAGTGATCCAGGCAGAGTTGTTCAGTGCAACCATGCGGTTCTG
GATTCTCTGGTGCTTTTGGCATGACTCAGATGCTGGGCTGGATGACCTTCCACATCCAGA
TCCTTCCCAGTAGATGGATGAAGAACTAGGCCTCCTTCCTGATGATGAAGAC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.05
SRP021940_embryo 0.12
SRP021940_placental_villous 0.04
SRP021940_synovial_membrane 0.13
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
APFVRLGGRLFLGRRV-RAAGGGARSAGGDVHIQPRYRQFPQLTRSQVIQAEFFSATMWFWILWRFWHDSDAVLGHFPYPDPSQWTDEELGILPDDED
APF...GG.LF.G.R...A.G.G.R...G.VHIQPRYR.FPQLTRS.VIQAE.FSATM.FWILW.FWHDSDA.L...P.PDPSQ..DEELG.LPDDED
Retrocopy
APFICVGGHLFRGIRS\AAGGSGVRHTSGGVHIQPRYRHFPQLTRS*VIQAELFSATMRFWILWCFWHDSDAGLDDLPHPDPSQ*MDEELGLLPDDED


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide