RetrogeneDB ID:
retro_ecab_594
Organism:
Horse ( Equus_caballus )
Location:
22:29424199-29424817 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
66.51 %
Coverage:
66.56 %
Frameshifts:
3
Stop codons:
2


Parental gene:
Parental gene symbol:
ATG3
Parental gene aliases:
No gene alias available
Parental gene description:
autophagy related 3 [Source:HGNC Symbol;Acc:20962]

Genomic region (view in browser)





>retro_ecab_594
AATGTGATTAACGTGGTGAAGGGAATGGCACTAGAAGTGACTGAGTACCTGAGCCTGGCC
CTCAAGGAGTCAAAATTTAAGGAAACAGACGTTGTCACCCCAGAACAGTTTGTGGCAGCT
GGAGATGCCTCAGTCCACCACTGTCCAACATGCTGGTGGGCTACAGGGAAAGAACTGAAA
GTGAAGGCATACCCACCAATAGTAAACAATTTTTGGTAACCAAAAATGTGCCATGCTACA
AGTGGGCAAACAGATGCAATCTTCGCATGAATTATAAACTATCACTGAAGAAGATGATGG
CGTTGGGGGATGGGTAGAGCCACATCACAGCACAGGAAGTGCAGGGATAACCAAAACAGC
TGAAGACATTACCCTGGAAAGCAAGGACAGTCTAAAACTCCAAGTTTGCTCAAAATAATG
TGAGGAGGAAGAAGAGGAAGATGAAAGAAAAGCTGCAAATATGGAAGAAAATGAAGAGAG
TGGATTGCTGGAAACGAGGCTATTCTAGATGCAAGGAAAACAGTAGAAGCTTGTAACCCT
AAAACGGATGTTGGAGGTGAGGCTGCTATTTTGCAAAGCAGAGCTTACGACCTCTACATC
ACTTATGAATATTACCAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
NVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLP-TGKQFLVTKNVPCYKRC-KQMEYSDELEAIIEE
NVIN.VKG.ALEV.EYL...LKESKFKET.V.TPE.FVAAGD..VHHCPT..WATG.ELKVKAY.P...KQFLVTKNVPCYK...KQM..S.EL..I.EE
Retrocopy
NVINVVKGMALEVTEYLSLALKESKFKETDVVTPEQFVAAGDASVHHCPTCWWATGKELKVKAYPP/NSKQFLVTKNVPCYKWA/KQMQSSHEL*TITEE


Parental protein
DDGDGGWVDTYHNTGIAGITEAVKEITLESKDSIKLQDCSALCEEEEEEDEGEAADMEEYEESGLL-ETDEATLDTRKIVEACKAKTDAGGEDAILQTRT
DDG.GGWV...H.TG.AGIT.....ITLESKDS.KLQ.CS..CEEEE.E.....A...E..E...L....EA.LD.RK.VEAC..KTD.GGE.AILQ.R.
Retrocopy
DDGVGGWVEPHHSTGSAGITKTAEDITLESKDSLKLQVCSK*CEEEE-EEDERKAANMEENEESGL/AGNEAILDARKTVEACNPKTDVGGEAAILQSRA


Parental protein
YDLYITYDKYYQ
YDLYITY..YYQ
Retrocopy
YDLYITYE-YYQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide