RetrogeneDB ID:
retro_ecab_596
Organism:
Horse ( Equus_caballus )
Location:
22:34818278-34818509 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
74.36 %
Coverage:
55.71 %
Frameshifts:
0
Stop codons:
1


Parental gene:
Parental gene symbol:
TMEM18
Parental gene aliases:
No gene alias available
Parental gene description:
transmembrane protein 18 [Source:HGNC Symbol;Acc:25257]

Genomic region (view in browser)





>retro_ecab_596
ATGCTGTCCGCCTTCTCAGTCAGCTCTTTCCCCACCAGCATTCCTGCTGTGATCATGCAG
ACAGACCGGACCGAGCTGCGGCTCATAGGGCTGCCTGGCTTCCATGTGGTCTGGCTGCTG
CTCACGTGTTTCTCCTTCCAGAGGTATAAACTGTAGGTGGGGCATTTCCTGTGCCTAATT
TTAGTCTGTTGTGCTGAATATATCAATGAAGTGGCAGCAATGAATTGGAGG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.29
SRP021940_cerebellum 0.2
SRP021940_embryo 0.24
SRP021940_placental_villous 0.18
SRP021940_synovial_membrane 0.29
SRP021940_testis 0.59

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MPSPFSVSSFPVSIPAVIAQTDWTEPWLLGLGGFHLLCLLLTWFSSKRYRLQVGHFLCLIALVCCAESINEVAALNWR
M.S.FSVSSFP.SIPAVI.QTD.TE..L.GL.GFH...LLLT.FS..RY.L.VGHFLCLI.LVCCAE.INEVAA.NWR
Retrocopy
MLSAFSVSSFPTSIPAVIMQTDRTELRLIGLPGFHVVWLLLTCFSFQRYKL*VGHFLCLI-LVCCAEYINEVAAMNWR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide