RetrogeneDB ID:
retro_ecab_607
Organism:
Horse ( Equus_caballus )
Location:
23:32435134-32435482 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
52.59 %
Coverage:
67.65 %
Frameshifts:
0
Stop codons:
3


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_ecab_607
AAAATACATGAACAAAATGAGAATTTCAACAAAGAAACAGATTTTACAAGAAAAAAACAA
GCAGAAATTACAGATATAAAGTAGACAATAAATGAAAGGAAAAATACAATAGACAGCTTT
AAGAGTAGGCTCAATCAGGCAGAAGAAAGAATCTGTGAGCTCAAAGACAGATCACTTGAT
ATTATCCAGTCAGAGGAGAATAAAGAAATTAGAATGAAAAAGAATGAAGAAAGGCTACAT
GAATTGTGAGATATGATCTAAAGAATCAATATCCCCACTATGGGAGTCCCAGAAGGAGCA
GAGAGGGAGAAAGGGGCAGAAATCTTATTTAAAGAATTAATGCCTGAC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.02
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RMDEHSGNFNKETDSIRKCQIEVTELKNTIPELTNTLEGFNSRLDEAEERISELNDRA-ELTQSEQQKEKRMKNTDNSLRELWDNIKHANIRIIGVPEGE
...E...NFNKETD..RK.Q.E.T..K.TI.E..NT...F.SRL..AEERI.EL.DR.....QSE..KE.RMK.....L.EL.D.I...NI...GVPEG.
Retrocopy
KIHEQNENFNKETDFTRKKQAEITDIK*TINERKNTIDSFKSRLNQAEERICELKDRSLDIIQSEENKEIRMKKNEERLHEL*DMI*RINIPTMGVPEGA


Parental protein
ERDKGAENLFVEIIQE
ER.KGAE.LF.E....
Retrocopy
EREKGAEILFKELMPD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide