RetrogeneDB ID:
retro_ecab_608
Organism:
Horse ( Equus_caballus )
Location:
23:38456295-38457234 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
97.76 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
RRAGB
Parental gene aliases:
No gene alias available
Parental gene description:
Ras-related GTP binding B [Source:HGNC Symbol;Acc:19901]

Genomic region (view in browser)





>retro_ecab_608
ATGCCAAATACAGCCATGAAGAAAAAGGTGCTGCTGATGGGGAAGAGCGGGTCGGGGAAG
ACCAGCATGCGGTCGATTATCTTTGCCAATTACATCGCTCGCGACACCCGGCGCCTGGGC
GCCACCATTGATGTGGAGCACTCCCACGTCCGATTCCTCGGCAACCTGGTGCTGAACCTG
TGGGACTGTGGCGGCCAGGACACCTTCATGGAAAACTACTTCACCAGCCAGCGAGACAAC
ATCTTCCGTAACGTCGAGGTCCTGATTTACGTGTTCGACGTGGAGAGCCGCGAACTGGAA
AAGGACATGCATTATTACCAGTCGTGTCTGGAGGCCATCCTCCAGAACTCCCCCGATGCC
AAAATCTTCTGCCTGGTGCACAAAATGGATCTGGTTCAGGAGGACCAGCGTGACCTGATT
TTTAAAGAGCGAGAGGAAGACCTGCGGCGTCTGTCTCGCCCCCTGGAGTGCGCCTGTTTT
CGAACATCCATCTGGGATGAAACGCTCTACAAAGCCTGGTCCAGTATTGTCTACCAGCTG
ATTCCCAACGTGCAGCAGCTGGAGATGAATCTGAGGAATTTTGCCCAAATCATCGAGGCC
GACGAAGTTCTGCTGTTCGAGAGAGCCACCTTCTTGGTCATCTCCCACTACCAGTGCAAG
GAGCAGCGTGACGTCCACCGGTTTGAGAAGATCAGCAACATCATTAAGCAGTTCAAGCTG
AGCTGCAGTAAATTGGCCGCGTCTTTCCAGAGCATGGAGGTCCGCAATTCCAACTTCGCC
GCCTTCATCGACATCTTCACGTCCAACACGTACGTGATGGTTGTCATGTCGGATCCGTCC
ATCCCTTCCGCGGCGACTCTGATCAACATTCGCAATGCCAGGAAACACTTTGAGAAGCTG
GAGAGAGTGGATGGCGCCAAGCACAGCCTCCTCATGCGT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 165.98
SRP021940_cerebellum 194.81
SRP021940_embryo 111.54
SRP021940_placental_villous 87.64
SRP021940_synovial_membrane 128.8
SRP021940_testis 65.63

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LPNTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTRRLGATIDVEHSHVRFLGNLVLNLWDCGGQDTFMENYFTSQRDNIFRNVEVLIYVFDVESRELE
.PNTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTRRLGATIDVEHSHVRFLGNLVLNLWDCGGQDTFMENYFTSQRDNIFRNVEVLIYVFDVESRELE
Retrocopy
MPNTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTRRLGATIDVEHSHVRFLGNLVLNLWDCGGQDTFMENYFTSQRDNIFRNVEVLIYVFDVESRELE


Parental protein
KDMHYYQSCLEAILQNSPDAKIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLECSCFRTSIWDETLYKAWSSIVYQLIPNVQQLEMNLRNFAEIIEA
KDMHYYQSCLEAILQNSPDAKIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLEC.CFRTSIWDETLYKAWSSIVYQLIPNVQQLEMNLRNFA.IIEA
Retrocopy
KDMHYYQSCLEAILQNSPDAKIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLECACFRTSIWDETLYKAWSSIVYQLIPNVQQLEMNLRNFAQIIEA


Parental protein
DEVLLFERATFLVISHYQCKEQRDAHRFEKISNIIKQFKLSCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKL
DEVLLFERATFLVISHYQCKEQRD.HRFEKISNIIKQFKLSCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKL
Retrocopy
DEVLLFERATFLVISHYQCKEQRDVHRFEKISNIIKQFKLSCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKL


Parental protein
ERVDGPKQCLLMR
ERVDG.K..LLMR
Retrocopy
ERVDGAKHSLLMR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide