RetrogeneDB ID:
retro_ecab_609
Organism:
Horse ( Equus_caballus )
Location:
23:39407772-39408207 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
97.24 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
1


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_ecab_609
ATGAAGTTCAACCCCTTTGTGACTGCTGACCGGAGCAAGAACCGTAAACGGCATTTCAAT
GCACCTTCCCACATTCGCAGGAAGATTATGTCTTCCCCTCTTTCCAAAGAGCTGAGACAG
AAGTACAATGTTCGGTCCATGCCCATCCGTAAGGATGATGAAGTTCAGGTTGTATGAGGA
CACTACAAAGGGCAGCAAATTGGCAAAGTAGTCCAGGTTTACAGGAAGAAATATGTCATC
TACATTGAGCGAGTGCAGCGGGAGAAGGCTAATGGCACAACTGTGCACGTGGGCATTCAC
CTGAGCAAGGTGGCTATTACTAGACTAAAACTGGACAAAGACCGCAAAAAGATCCTTGAA
CGTAAAGCCAAATCTCGCCAAGTAGGAAAGGAAAAGGGCAAATATAAGGAAGAAACAATC
GAGAAAATGCAGGAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 12.37
SRP021940_cerebellum 3.83
SRP021940_embryo 18.95
SRP021940_placental_villous 4.78
SRP021940_synovial_membrane 9.82
SRP021940_testis 3.03

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MKFNPFVTSDRSKNRKRHFNAPSHIRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIH
MKFNPFVT.DRSKNRKRHFNAPSHIRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVV.GHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIH
Retrocopy
MKFNPFVTADRSKNRKRHFNAPSHIRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVV*GHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIH


Parental protein
PSKVVITRLKLDKDRKKILERKAKSRQVGKEKGKYKEETIEKMQE
.SKV.ITRLKLDKDRKKILERKAKSRQVGKEKGKYKEETIEKMQE
Retrocopy
LSKVAITRLKLDKDRKKILERKAKSRQVGKEKGKYKEETIEKMQE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide