RetrogeneDB ID:
retro_ecab_61
Organism:
Horse ( Equus_caballus )
Location:
10:22335488-22336925 (-)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
65.12 %
Coverage:
56.73 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_ecab_61
GCTTTTAGGAAAAGCTCATACCTCTCAAAACATGAGAGAATTCATTCTGCACAGAGACCT
TACAAATGTAATGAGTGTGGCAAAGCTTTTAATAAGTGCTTGAACCTTAGTAGACATCAG
AAAATCCATACAAGAGAGAAACCATATAATTGTGATGTGGGTGGCAAAATCTTTCATCAG
AATTCAAACCTTGCAAGTCATCAGAGAATGGATACTGGCGAGAAACCTTACAAATGTAAT
GACTGCAGCAAGGCCTTTGCTAAACACTCAAGGCTTACTCAACATAAAAGAGTCCATACT
GGAGAGAAACCTTACAAATGTAATGAATGCAGCAAAGCCTTTGCTAGATGTTCAAGCCTT
ACTCAGCATAAGAGAATCCATACTGGAGAGAAACCTTACAAATGTAGTGAATGCAGCAAA
GCCTTTGCTGAACACTCAAAGCTTACTCAACATAAAAGAATCCATACTGGAGAAAAACCT
TACAAATGTAATGAATGCAAGAAAGCCTTTGCTAGACATTCAAGCCTTACTCAACATAAG
AGAATCCATACTGGAGAGAAACCTTACAAATGTAATGAATGCAGCAAAGCCTTTCCTAGA
CACTCAATGCTTGCTCAACATAAAAGAATCCATACTGGAGAAAAACCTTACAAATGTAAT
GAATGCAGCAAGTCCTTTGCTAAACGCTCAAGGCTTACTCAACATAAAAGAATCCATAAT
GGAGAGAAACCTTACAAATGTAGTGAATGCAGCAAAGCCTTTGCTAGACATTCAGGTCTT
ACTCAACATAAGATAATCCATACTGAAGAGAAACCTTGCAAATGTAGTAAGTGTGGCAAG
GTATTTAGTCAAAAGTCAAGCCTTGAAAGTCATCAGAGAATTCATACTGGTGAGAAACCT
TACAAATGTAATGAGTGTGGCAAATCTTTTACCCATTTTGTGTGCCTTAAAAGACATCAG
AAAATCCATACTGGAGAGAAACCTTACAAATGTAATGAGTGTGGCAAATCTTTTAACCGA
TTTGAAAGCCTTACAATACATCAGAAAATCCATACTGGAGAGAAACCTTACAAATGTAAT
GAGTGTGGTAAAGCCTTTATGGATGTTTCATACGTTACTCGACATAAAAAAATCCATACT
GGAGAGAAACCTTTCAAATGTAATGAGTGTGGCAAAACTTTTATGCAGGGTTCACATCTT
ACTCGACATAAGAAAATCCATACTGGAGAGAAACCTTACAAATGTAATGAGTGTGGCAAG
GTCTGTAATCAAAAGTCAAACCTTGCAATTCATCAGAGAATTCATACTGGAGAGAAACCT
TACAAATGTAATGAATGTGGCAAAGTGTTTGCTGAGCGTTCAAGACTTACTCAGCATAAG
AGAATCCATACTGGAGAGAAACCTTTCAAATGTACTGAGTGTGGCAAAACTTTTATG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.52
SRP021940_cerebellum 0.15
SRP021940_embryo 1.58
SRP021940_placental_villous 0.09
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.18

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SNLTIHQRTHTGEKPYKCNECGKAFMERSSLTQHTRIHSGEKPYSCKECGKAFNQSSNLVIHQIIHTGEKPYKCNVCGKAFNVCSSLTRHQTIHTGEKPY
S.L..H.R.H....PYKCNECGKAF.....L..H..IH..EKPY.C...GK.F.Q.SNL..HQ...TGEKPYKCN.C.KAF...S.LT.H...HTGEKPY
Retrocopy
SYLSKHERIHSAQRPYKCNECGKAFNKCLNLSRHQKIHTREKPYNCDVGGKIFHQNSNLASHQRMDTGEKPYKCNDCSKAFAKHSRLTQHKRVHTGEKPY


Parental protein
KCTQCGKAFSHCSTLANHQRIHSDERPYKCNECGRAFNRFSNLTRHQRIHTGEKPYKCNVCGKDFMIRSHLWSHERIHTGEKPYKCNECGKAFSERSNLA
KC..C.KAF..CS.L..H.RIH..E.PYKC.EC..AF...S.LT.H.RIHTGEKPYKCN.C.K.F...S.L..H.RIHTGEKPYKCNEC.KAF...S.LA
Retrocopy
KCNECSKAFARCSSLTQHKRIHTGEKPYKCSECSKAFAEHSKLTQHKRIHTGEKPYKCNECKKAFARHSSLTQHKRIHTGEKPYKCNECSKAFPRHSMLA


Parental protein
QHKRIHTGEKPYKCNECGKDFTTRSHLWGHERIHTGEKPYKCNECGKAFTGSSNLTQHKKIHTGEKPYKCTVCGKAFSQNSSLIVHQRIHTGEKPYKCHE
QHKRIHTGEKPYKCNEC.K.F..RS.L..H.RIH.GEKPYKC.EC.KAF...S.LTQHK.IHT.EKP.KC..CGK.FSQ.SSL..HQRIHTGEKPYKC.E
Retrocopy
QHKRIHTGEKPYKCNECSKSFAKRSRLTQHKRIHNGEKPYKCSECSKAFARHSGLTQHKIIHTEEKPCKCSKCGKVFSQKSSLESHQRIHTGEKPYKCNE


Parental protein
CGKAFKQSETLQRRTKIHTEERPYKCKECGKAFNRYSNFTIHQRIHTGEKPYKCKECGQAFTWCSSLTIHQRIHTGEKPYKCKVCCKAFNQYSNLTKHQR
CGK.F.....L.R..KIHT.E.PYKC.ECGK.FNR....TIHQ.IHTGEKPYKC.ECG.AF...S..T.H..IHTGEKP.KC..C.K.F.Q.S.LT.H..
Retrocopy
CGKSFTHFVCLKRHQKIHTGEKPYKCNECGKSFNRFESLTIHQKIHTGEKPYKCNECGKAFMDVSYVTRHKKIHTGEKPFKCNECGKTFMQGSHLTRHKK


Parental protein
IHTGEKPYKCKECCKAFTWYTSLTIHQRIHTGEKPYKCKEC-SIFNQYSYLTIHQRIHTGEKPYKCKECGKAF
IHTGEKPYKC.EC.K.......L.IHQRIHTGEKPYKC.EC...F...S.LT.H.RIHTGEKP.KC.ECGK.F
Retrocopy
IHTGEKPYKCNECGKVCNQKSNLAIHQRIHTGEKPYKCNECGKVFAERSRLTQHKRIHTGEKPFKCTECGKTF


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide