RetrogeneDB ID:
retro_ecab_610
Organism:
Horse ( Equus_caballus )
Location:
23:55576965-55577305 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
51.3 %
Coverage:
68.26 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
ZBTB8OS
Parental gene aliases:
No gene alias available
Parental gene description:
zinc finger and BTB domain containing 8 opposite strand [Source:HGNC Symbol;Acc:24094]

Genomic region (view in browser)





>retro_ecab_610
TTGAGAGGCTACAGCTTGACCAAGAAGCAGGAGGTAACCAAAGCCAACTTTCCTCTATCT
AGTCAGAAGTATGAATACCTGGATCACACAGCCAATGTCCAGTTACACATATGGAGAGAT
ACTTTGCAGAGAGTCTTTAAGCACCGTATGATGGCCGTGGTTGCTTACTTGACAGATACT
AGGGTCATCAAGCCCCTGAAAATAGGAGTAAATATGCAAGGAGATGCCTTGGCAATCTTT
CTGGCTTCATGTTTTGGATAAGCAGCTTTATAAATTTAGGCCTGTTGAGTTTTTCATGCC
CTGGGTAGCAAAAATATTCACTATTGACCAAAGGAATTTC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.75
SRP021940_cerebellum 0.0
SRP021940_embryo 1.51
SRP021940_placental_villous 0.31
SRP021940_synovial_membrane 0.29
SRP021940_testis 0.18

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VRDYNLTEEQKAIKAKYPPVNRKYEYLDHTADVQLHAWGDTLEEAFEQCAMAMFGYMTDTGTVEPLQTVEVETQGDDL-ESLLFHFLDEWLYKFSADEFF
.R.Y.LT..Q...KA..P....KYEYLDHTA.VQLH.W.DTL...F....MA...Y.TDT....PL....V..QGD.L..S...H.LD..LYKF...EFF
Retrocopy
LRGYSLTKKQEVTKANFPLSSQKYEYLDHTANVQLHIWRDTLQRVFKHRMMAVVAYLTDTRVIKPLK-IGVNMQGDAL\QSFWLHVLDKQLYKFRPVEFF


Parental protein
IPREAKVLNIDQRNF
.P..AK...IDQRNF
Retrocopy
MPWVAKIFTIDQRNF


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide