RetrogeneDB ID:
retro_ecab_614
Organism:
Horse ( Equus_caballus )
Location:
23:14652504-14653287 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
72.08 %
Coverage:
100.0 %
Frameshifts:
3
Stop codons:
1


Parental gene:
Parental gene symbol:
RPS4
Parental gene aliases:
No gene alias available
Parental gene description:
40S ribosomal protein S4 [Source:UniProtKB/Swiss-Prot;Acc:P55832]

Genomic region (view in browser)





>retro_ecab_614
GCTCATGGTCCCAAGAAGCATCTGAAGTGTACAGCAGCTCCAAAGCACTGGATGCTGGAT
AAACTGATCTGTGTGTTTGTTCCTTGTCCATCAACTGGTCCCTATAAGCGGAGAGAATGC
CTCTCCCTCATCTTTTTTTAAAGAACAGACTTAAGTATGCCCCGGCAGGAAAGAAGTAAG
GAAGATCTTCATGCAGCAGTTCTTTAAGATTGATGGCAAGGTCCAAACCGATACAGCCTA
CCCTGATGGTTTTAAGGACGTCATCAGCATTGACAAGACGAGGGAGACTTTCTGTCTGAT
CCACGACACCAAGTGTTGCTTTGCTGTTCATTGTATTATACCTGAGGAGGCCAAGAACAA
GTTGCGCAAAGTGAGAAAGATCTTTATGGGCACAAAAGGAATTCCTCATCTGATGACCGA
GGATGCTCACGCATTCCACTACCCGGATCCCCTCGTCAAAGTGAACGATGCCTTTCAGAT
CGATTTGGAGACTGGCAAGATTAGCAAGTTCATCAGGTCTGACACTGGTGACCTGTGTAT
GGTGAGCAGAGGTGCTAAGCTGGGAAGAATTGGTGCGATCACCAACAGTGAGAGACATCT
TGGTTCTTTTGATGTGGTCCATGTGAAAGACGCCAACGGCAACAGCTTTGCCACTTGGCT
CTCCAACATTTTCATTACTGCAAAGACAGCAAACGACGGCTTTCTCTTCCCTGAGGAAAA
CATTATCGTCTCACCATTGCTGAAGAGAGACACGAGAGACTGCCAGGCAAACAGAGCAGT
GGG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.14
SRP021940_placental_villous 0.18
SRP021940_synovial_membrane 0.1
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLI-IFLRNRLKYALTGD-EVKKICMQRFIKIDGKVRTDITYPAGFMDVISIDKTGENF
A.GPKKHLK..AAPKHWMLDKL..VF.P.PSTGP.K.RECL.LI..FL.NRLKYA..G..EV.KI.MQ.F.KIDGKV.TD..YP.GF.DVISIDKT.E.F
Retrocopy
AHGPKKHLKCTAAPKHWMLDKLICVFVPCPSTGPYKRRECLSLI/LFLKNRLKYAPAGK/EVRKIFMQQFFKIDGKVQTDTAYPDGFKDVISIDKTRETF


Parental protein
RLIYDTKGRFAVHRITPEEAKYKLCKVRKIFVGTKGIPHLVTHDARTIRYPDPLIKVNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLGRIGVITNRE
.LI.DTK..FAVH.I.PEEAK.KL.KVRKIF.GTKGIPHL.T.DA....YPDPL.KVND..QIDLETGKI..FI..DTG.LCMV..GA.LGRIG.ITN.E
Retrocopy
CLIHDTKCCFAVHCIIPEEAKNKLRKVRKIFMGTKGIPHLMTEDAHAFHYPDPLVKVNDAFQIDLETGKISKFIRSDTGDLCMVSRGAKLGRIGAITNSE


Parental protein
RHPGSFDVVHVKDANGNSFATRLSNIFVIG-KGNKPWISLPRGKGIRLTIAEERDKRLAAKQSSG
RH.GSFDVVHVKDANGNSFAT.LSNIF....K..K...SLP.GK..RLTIAEER..RL..KQSSG
Retrocopy
RHLGSFDVVHVKDANGNSFATWLSNIFITA/KDSKRRLSLP*GKHYRLTIAEERHERLPGKQSSG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide